KEGG   Bacillus subtilis subsp. subtilis 168: BSU11980
Entry
BSU11980          CDS       T00010                                 

Symbol
yjdA
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short KR YjeF_N Epimerase RmlD_sub_bind
Other DBs
NCBI-GeneID: 939818
NCBI-ProteinID: NP_389080
Pasteur: BG13173
BSORF: BG13173
UniProt: O31642 A0A6M4JH16
Position
1268829..1269584
AA seq 251 aa
MSHSQEKIALITGASSQGDIGTAICRKLASQGIHIFFTHWNSDTAWIEEFQQEILRMGVR
CEAMKIDLSDAHAAFTIHEKISDKLGYPSILINNAAHSASDNYVSLDAKSLDEHYAVNMR
SNFLLCVEFARRFKKSNLISGRIINMTSGQDLGPLPGELAYAATKGAISAFTRSLSQELA
PLGITVNAVNPGPTDSTWMTDEIRNFLSPKFPMGRIGTPDDAARMIAFLASDEAEWITGQ
IIHSEGGFIRG
NT seq 756 nt   +upstreamnt  +downstreamnt
atgagtcattctcaagaaaaaattgcactaattacaggagcaagcagtcaaggggatatt
ggtacggctatttgtcgtaagttagcctcacagggtatacatatcttctttactcactgg
aattctgatacggcctggatagaagaatttcaacaagaaattttacgtatgggtgtccgc
tgtgaggcaatgaaaattgatttatcagatgcacatgctgcattcacaatacatgaaaaa
atttcagataaattaggatatccttccatccttattaataatgcagctcattccgcaagt
gataattatgtatcgttagatgctaaatcacttgatgagcattatgcggttaatatgaga
tcgaattttcttctttgtgttgaattcgcccgtcggtttaaaaaatctaatttaatatca
ggaagaatcatcaatatgacatcagggcaggatttaggtcctttgcctggggagttagcg
tatgcagcaactaaaggagctatttctgcatttactaggtcgttatcacaagaacttgca
ccattgggcatcactgttaacgccgtaaacccaggtccaacagattctacatggatgaca
gatgaaataagaaattttctttcacctaaatttccaatggggcgtattggcacaccagat
gatgcagcacgaatgattgcctttcttgcaagtgatgaggctgaatggataactggacaa
attattcattcagaaggtggatttattcggggctaa

DBGET integrated database retrieval system