KEGG   Bacillus subtilis subsp. subtilis 168: BSU11990
Entry
BSU11990          CDS       T00010                                 

Gene name
yjdB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Big_2
Other DBs
NCBI-GeneID: 936431
NCBI-ProteinID: NP_389081
Pasteur: BG13174
BSORF: BG13174
UniProt: O31643 A0A6M4JIT5
Position
complement(1269733..1270080)
AA seq 115 aa
MNFKKTVVSALSISALALSVSGVASAHEINSTPTEVKNISISPTHVIKIQDYNLPLKVGE
TYSVKNNSATRYWTDNQKVAEVDQNGLVTAKSKGKATITLFKGTAVFGKVYVTVY
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaatttcaaaaaaacggttgtttctgctttatcgatttctgcgttagctctgtcggtc
agcggggtagcttcagctcatgaaataaactccacacctactgaagtaaagaacatttct
atttcacctacacatgttatcaagattcaagactataatttacctctaaaagttggagaa
acctattctgttaaaaataattcagctactcgttattggactgataaccaaaaagttgct
gaagtcgatcaaaatggtttagtgacggctaaatcaaaagggaaagccacgattactttg
tttaaaggtactgcagtattcggaaaagtatatgtaacggtttattaa

DBGET integrated database retrieval system