KEGG   Bacillus subtilis subsp. subtilis 168: BSU12000
Entry
BSU12000          CDS       T00010                                 

Gene name
manR
Definition
(RefSeq) transcriptional regulator ManR
  KO
K02538  activator of the mannose operon, transcriptional antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU12000 (manR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   BglG family
    BSU12000 (manR)
SSDB
Motif
Pfam: PRD PTS_EIIA_2 HTH_11 Mga PuR_N HTH_DeoR PTS_IIB EutA HTH_Mga Fe_hyd_lg_C GerE
Other DBs
NCBI-GeneID: 939394
NCBI-ProteinID: NP_389082
Pasteur: BG13175
BSORF: BG13175
UniProt: O31644 A0A6M4JFE9
Position
1270631..1272577
AA seq 648 aa
MEYINTRQKEILYLLLSEPDDYLVVQDFADRVQCSEKTIRNDLKVIEDYLNEHSHAQLIR
KPGLGVYLHIEEQERTWLSQQLHTEHFSSRQRSDKERMLHIAYDLLMNPKPVSAKDIAAR
HFVNRSSIKKDLYAVEEWLKRFDLTLVSRQRLGLKVEGNERNKRKALARISDLIHNTAFT
SQFIKSKFLHYEVDFVTKEIKSLQKKHSLYFTDETFESLLLHTLLMVRRIKMKQPISLSP
KEMAAVKKKKEYQWTFACLQRLEPVFAIRFPEEEAVYLTLHILGGKVRYPLQTEENLENA
VLPKVVGHLINRVSELKMMDFHKDQDLINGLNIHLNTVLQRLSYDLSVANPMLNDIKKMY
PYLFHLIIDVLEDINQTFDLHIPEEEAAYLTLHFQAAIERMQGSSETHKKAVIVCHMGIG
MSQLLRTKIERKYHQIAVMACIAKADLKDYIKKHEDIDLVISTIALENITVPHIVVSPLL
EPGEEKKLSAFIRQLGESHRQKQKTFQMLNNTTPFLVFLQQEAEHRYKLIEQLATALFEK
GYVDKDYAVHAVMREKMSATNIGSGIAIPHANAKFIKQSAIAIATLKEPLEWGNEKVSLV
FMLAVKHEDQTMTKQLFSELSYLSEQPAFVQKLTKETNVMTFLSHLDY
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggaatacataaatacaagacaaaaagagattttgtatctgttgttatctgaacctgat
gactatttagttgtgcaagatttcgcagatagggtacagtgttctgaaaaaacaatccgg
aatgatttgaaagtgatcgaggattatctcaatgagcattctcatgcacagcttattcga
aaaccagggttgggcgtttatttacatatagaagaacaggaaaggacctggctaagccaa
caattacatactgaacatttttcttctaggcagcggagcgataaggaaagaatgctgcac
attgcttatgacttattaatgaatccgaagcctgtttccgcaaaagacattgccgctcgg
cattttgtcaatcgatcttccattaaaaaggatttatacgcagtagaagagtggctgaag
cgttttgatctcacactggtttctaggcagcggcttggattaaaggttgaagggaacgaa
agaaataaaagaaaggcattggcaagaatatctgatttgattcacaatacagcgtttacc
agccaatttattaaaagtaagtttttacattatgaagtagactttgtgacgaaagaaatc
aaatcactacaaaaaaagcattccctctatttcacagacgaaacgtttgaaagtttgttg
ctgcatacattgttaatggtccgccgcatcaaaatgaagcagccgatttcattgtcccca
aaagaaatggcggcagtaaaaaagaagaaagaatatcaatggacatttgcttgtttacag
cggcttgaaccggtttttgcaattcgcttccctgaagaagaagccgtgtacttaacatta
catatattgggcggtaaggttcgttatccattgcagacagaagagaaccttgaaaatgct
gtgcttcctaaggttgtagggcatttaatcaatcgtgtttcagagctgaaaatgatggat
tttcacaaggatcaggatttgatcaatggtttgaacattcatctcaatactgtgctacaa
cggctgagctacgatctttctgtagcaaatcctatgctcaatgacatcaaaaagatgtac
ccttatttgttccacctcatcattgatgttttggaagacatcaatcaaacttttgatctt
catattcctgaggaagaggcagcatatttgacattgcattttcaggcagcgatcgaacgg
atgcagggcagcagcgagacacataaaaaggcggttatcgtctgccacatggggattggg
atgtcacaattgctgcggacaaaaattgaacggaaatatcaccaaatcgctgtaatggct
tgtattgcaaaggccgatttaaaggattatatcaaaaagcatgaggatattgatcttgtc
atatccaccattgcgctggagaatataacggttccccatattgttgtgtctccgctttta
gagcctggcgaagagaagaaattaagtgcgtttatacgtcagctgggcgaatcacaccgc
caaaaacaaaaaacgtttcagatgctgaacaatacgactccttttttggtttttttgcag
caggaggcggagcatcgctacaagttaatcgaacagctggcgacagctttgtttgagaaa
ggctatgttgataaggactatgcggttcatgcggtgatgagggaaaaaatgtcggctaca
aatattgggtcaggcattgccattcctcatgcaaacgctaaatttattaaacaatcagca
atcgcgattgccacattaaaggagccgcttgaatggggaaatgaaaaagtttcgctcgtt
tttatgctggctgtcaaacacgaggatcaaactatgacaaagcagctgtttagcgagctt
tcatatcttagcgagcagccggccttcgtccagaagctgacgaaagaaaccaatgtcatg
acatttttatctcatttggattattaa

DBGET integrated database retrieval system