KEGG   Bacillus subtilis subsp. subtilis 168: BSU12010Help
Entry
BSU12010          CDS       T00010                                 

Gene name
manP
Definition
(RefSeq) PTS system-mannose-specific transporter subunit EIIBCA
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
K02770  PTS system, fructose-specific IIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU12010 (manP)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU12010 (manP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12010 (manP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     BSU12010 (manP)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    BSU12010 (manP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS_EIIC PTS_IIB Rhomboid
Motif
Other DBs
NCBI-GeneID: 936437
NCBI-ProteinID: NP_389083
Pasteur: BG13176
BSORF: BG13176
UniProt: O31645
Structure
PDB: 

Position
1272725..1274677
Genome map
AA seq 650 aa AA seqDB search
MKLLAITSCPNGIAHTYMAAENLQKAADRLGVSIKVETQGGIGVENKLTEEEIREADAII
IAADRSVNKDRFIGKKLLSVGVQDGIRKPEELIQKALNGDIPVYRSATKSESGNHQEKKQ
NPIYRHLMNGVSFMVPFIVVGGLLIAVALTLGGEKTPKGLVIPDDSFWKTIEQIGSASFS
FMIPILAGYIAYSIADKPGLVPGMIGGYIAATGSFYDSASGAGFLGGIIAGFLAGYAALW
IKKLKVPKAIQPIMPIIIIPVFASLIVGLAFVFLIGAPVAQIFASLTVWLAGMKGSSSIL
LALILGAMISFDMGGPVNKVAFLFGSAMIGEGNYEIMGPIAVAICIPPIGLGIATFLGKR
KFEASQREMGKAAFTMGLFGITEGAIPFAAQDPLRVIPSIMAGSMTGSVIAMIGNVGDRV
AHGGPIVAVLGAVDHVLMFFIAVIAGSLVTALFVNVLKKDITASPVLSETAPTSAPSEAA
AANEIKQPIQSQKAEMSEFKKLTDIISPELIEPNLSGETSDDIIDELIQKLSRRGALLSE
SGFKQAILNREQQGTTAIGMNIAIPHGKSEAVREPSVAFGIKRSGVDWNSLDGSEAKLIF
MIAVPKESGGNQHLKILQMLSRKLMDDNYRERLLSVQTTEEAYKLLEEIE
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttagcgattacatcttgtccgaatggaatcgcccatacgtatatggcagca
gaaaatctgcaaaaagctgctgacagactgggcgttagcatcaaagttgagacccaggga
gggattggtgttgaaaataagctaaccgaagaggaaattcgcgaagcggacgcaatcatt
attgctgcagaccgttcggtaaacaaagaccggtttataggcaaaaaactgctgtctgtg
ggggtacaggacggtatccgcaaaccggaagaattgattcaaaaagctcttaacggggat
ataccggtctatcgttccgctacaaaatcggaatccggtaatcatcaggagaagaaacaa
aatccaatttaccgtcatttaatgaacggcgtttcatttatggttcctttcattgttgtc
ggcggattattgatagcggttgcattaacgcttggaggggagaaaacacctaaaggctta
gttattccggatgattccttctggaaaacgattgaacagatcggcagtgcttcattttca
tttatgattccgattttagccggctatatcgcctatagcatcgctgataaaccggggctt
gtgccaggtatgatcggcggttatattgcggcgactggaagtttttatgacagcgcaagc
ggcgccggattcctcggggggattattgccgggtttttggccggatacgcggcactttgg
atcaaaaaattaaaagttccaaaagccatccagccgattatgccgattattattattccg
gtgtttgcatcactgattgtaggtttagcgtttgtgtttttgatcggcgcgcctgtagct
caaattttcgcctctttaacagtttggctggcggggatgaaagggtcgagctcgatcctt
ctggcattgattttaggggcgatgatctcatttgatatgggcggtcccgtaaataaggtg
gcgtttctgtttggatcggcaatgattggagaaggaaattatgaaattatgggaccaatt
gctgtcgccatttgtatccccccgattggccttggcattgcgacgtttttaggaaaaaga
aaattcgaggcatctcaaagagaaatggggaaagcggcatttacgatggggctcttcggc
attactgaaggagcgattccatttgcggcgcaggaccctctgcgcgttattccaagtatt
atggcaggctcaatgacaggttctgtgatagccatgattggcaatgtgggagacagagtg
gcgcacggcggacctatcgttgcagtgcttggcgcagttgatcatgtcttgatgtttttt
attgctgtgattgcaggatctcttgtcactgctctgttcgtcaatgtactaaaaaaggat
attacggcgtctcctgtgctcagtgaaactgcaccgacctccgcgccaagtgaagctgcg
gcagcaaatgaaataaagcagccaattcaaagccaaaaagctgagatgtcggaatttaaa
aaactgacagacattatcagcccggaattaattgaaccaaatttatcgggggaaacgagt
gatgacatcatagatgaattgattcagaaattgtcacgaagaggtgcgctgctttcagag
agcgggtttaaacaagccattttgaatcgtgaacaacagggaacaacggcgattggcatg
aatatcgcgattccgcacggaaagtctgaggcggtcagggagccgagtgttgcctttggg
atcaaacgatcaggcgttgattggaatagcctggatggatcagaagctaaattaatcttt
atgattgctgtaccgaaagagagcgggggaaaccagcatctcaaaatactgcagatgcta
tctcgaaagctaatggatgacaattatagggagcggctgctctccgtgcaaacaacagaa
gaagcatacaagctgctagaagaaatcgaataa

DBGET integrated database retrieval system