KEGG   Bacillus subtilis subsp. subtilis 168: BSU12030
Entry
BSU12030          CDS       T00010                                 

Symbol
yjdF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2992
Other DBs
NCBI-GeneID: 939820
NCBI-ProteinID: NP_389085
Pasteur: BG13178
BSORF: BG13178
UniProt: O31647 A0A6M3ZKT0
Position
1275809..1276291
AA seq 160 aa
MSVTFPSSGCPSFFNIFYEEGIVMKLTIYYDGQFWVGVVEVVDNGKLRAFRHLFGKEPRD
SEVLEFVHNQLLNMMAQAEQEGVRLQGRRQKKINPKRLQRQVSKELKNAGVTSKAQEAIK
LELEARKQKKKQIMKEQREHVKEQRYMLKKQKAKKKHRGK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtcagtaaccttcccctcctcgggatgtccatcattctttaatatcttttatgaggag
ggaatcgttatgaaattaacgatttactacgatggtcagttttgggtaggcgttgttgaa
gttgtggacaatggaaagctaagagcctttcgtcatctttttggcaaagagccgagggat
tctgaagtattagagtttgttcataaccaacttttgaatatgatggcccaagctgagcag
gaaggagtgcgtttacaaggcaggcgtcaaaaaaagatcaatccaaaaagattgcagcgc
caggtttcaaaagagttgaaaaacgccggagtaacttctaaagctcaagaggcgataaag
ctagagcttgaagcaagaaagcaaaagaaaaaacaaataatgaaagaacaacgagaacat
gtaaaagagcaaaggtatatgctcaaaaagcaaaaagcgaaaaagaagcacagaggtaaa
taa

DBGET integrated database retrieval system