KEGG   Bacillus subtilis subsp. subtilis 168: BSU12040
Entry
BSU12040          CDS       T00010                                 

Symbol
yjdG
Name
(RefSeq) N-acetyltransferase YjdG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 GNAT_acetyltran FR47 Acetyltransf_8 Acetyltransf_7
Other DBs
NCBI-GeneID: 936436
NCBI-ProteinID: NP_389086
Pasteur: BG13179
BSORF: BG13179
UniProt: O31648 A0A6M4JF21
Position
complement(1276337..1276843)
AA seq 168 aa
MVLLETNRLRLQTIDIPLLDAASKQDHQAIKELGYETNGEWPNSDFFEAIPYFREILVKN
NGTKGFDSWIIVKKDNYEIVGGTGFLGDPDENGMIEIGFATNKSHRRKGYCVEAAQKLIN
WALSRETVSRITARCEHDNLGSQKTLEKLGFILNHKSAEYKHWIYVTK
NT seq 507 nt   +upstreamnt  +downstreamnt
atggttctccttgaaacgaatcgattacgattacaaacgattgatattccccttcttgac
gccgcgtctaaacaagatcatcaggctatcaaagaattaggctatgaaacaaatggtgaa
tggccaaattctgatttttttgaagcgataccttatttccgcgagattttagtcaaaaac
aatggaacaaaaggatttgattcatggattattgtaaagaaggacaattatgaaattgtt
gggggaactggatttttaggtgacccagacgaaaatggcatgattgaaatcggttttgca
acaaataaaagtcatcgccgcaaaggttattgtgtggaagccgcccaaaaactaataaac
tgggcattaagccgagaaacagtatcccggatcaccgcaagatgcgaacatgataatcta
ggctcacaaaaaaccttggagaagttagggtttatattgaatcataaatcagcggagtat
aaacattggatatatgttacaaagtag

DBGET integrated database retrieval system