KEGG   Bacillus subtilis subsp. subtilis 168: BSU12050
Entry
BSU12050          CDS       T00010                                 

Gene name
yjdH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939819
NCBI-ProteinID: NP_389087
Pasteur: BG13180
BSORF: BG13180
UniProt: O31649 A0A6M3ZEW4
Position
complement(1277062..1277457)
AA seq 131 aa
MYHYFYGPALIPYFSHTHNPQRSPDFSERQRRREITLTVDGFVPPSSTEDLGDGFYSYAW
TNQQVINPGEYLVCHLEGRDINVINGGFTPRDTAPLYAVASFPRRRNQWVIIIHNPVQTQ
RAISLYLIAKR
NT seq 396 nt   +upstreamnt  +downstreamnt
ttgtatcattacttttatggccctgcgttaattccttacttttcacatactcataaccct
caaagaagtccagacttttcagaaagacagcgaagaagagaaatcacattgactgtagat
ggctttgtccccccatcttccaccgaagatcttggagacggcttttattcttacgcatgg
acgaaccaacaggtcatcaatccaggtgaatacttagtttgtcatcttgaaggaagagat
atcaacgtgataaatggtgggttcactccgcgcgatactgctccattgtatgcggtagca
agctttccaagacgaagaaaccaatgggtcattatcattcataatcctgtgcaaacccaa
agagccatatcgctttatttgattgcgaaaaggtag

DBGET integrated database retrieval system