KEGG   Bacillus subtilis subsp. subtilis 168: BSU12060
Entry
BSU12060          CDS       T00010                                 

Gene name
yjdI
Definition
(RefSeq) Cys-tRNA
  KO
K03976  Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase [EC:3.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU12060 (yjdI)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     BSU12060 (yjdI)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    BSU12060 (yjdI)
SSDB
Motif
Pfam: tRNA_edit
Other DBs
NCBI-GeneID: 936435
NCBI-ProteinID: NP_389088
Pasteur: BG13181
BSORF: BG13181
UniProt: O31650 A0A6M4JH57
Position
1277686..1278165
AA seq 159 aa
MAKKMAKTNAVRLIEQQNISYEVLGYKTDGQPVDGISVAEKIGYSLKYVYKTLVAAAGTN
HYYVFVVPVAEELDVKKAAKVTGEKKIEMIAMKELLAVTGYLRGGCSPIGMKKLFPTYID
ASAETLDFIIVSAGKIGMQLKLAPQDLARSCDAAFAEIV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcgaaaaaaatggcaaaaacaaatgcggttcgtctgatagaacagcagaacatctct
tatgaggtattagggtataaaacagacggccagccggtagatggcatctctgttgcggaa
aaaatcggttattctttgaaatatgtatataaaacgttggttgcagcagcaggaacaaat
cattattatgtctttgttgtacccgttgcagaagagttagatgtaaaaaaggcagcaaag
gtgacaggggaaaagaaaatagaaatgattgcaatgaaggagctgttagcggtaactggc
tatcttcgcggcggctgctcgccaattggcatgaaaaaattgttcccgacctatattgat
gcatctgcagaaacgcttgattttattattgtcagtgcagggaaaatcggtatgcagcta
aagttggcgccacaagatttagccagatcatgtgatgccgcatttgcagaaattgtatag

DBGET integrated database retrieval system