KEGG   Bacillus subtilis subsp. subtilis 168: BSU12069
Entry
BSU12069          CDS       T00010                                 

Gene name
yjzH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4177 BTRD1 DUF6127 Adeno_E1B_55K
Other DBs
NCBI-GeneID: 8303219
NCBI-ProteinID: YP_003097709
UniProt: C0H3Z2 A0A6M4JHJ4
Position
complement(1278205..1278399)
AA seq 64 aa
MKEYEFVRVELSTMRRRPKEDYQQIIHDYAKRGWRFVQIFAPSIDGYGAAAYFEIIFERD
AEKA
NT seq 195 nt   +upstreamnt  +downstreamnt
atgaaagaatatgaattcgtaagagttgagctgagtacgatgagaagaaggcctaaagaa
gactaccagcaaatcatccatgattatgcgaaaagaggctggagattcgttcagattttc
gctcccagtatagatgggtatggggcagctgcttattttgaaatcatatttgaaagggat
gcggaaaaagcttaa

DBGET integrated database retrieval system