KEGG   Bacillus subtilis subsp. subtilis 168: BSU12070
Entry
BSU12070          CDS       T00010                                 

Symbol
yjdJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4306 MARVEL
Other DBs
NCBI-GeneID: 936449
NCBI-ProteinID: NP_389089
Pasteur: BG13182
BSORF: BG13182
UniProt: O31651 A0A6M3Z9U1
Position
complement(1278565..1278894)
AA seq 109 aa
MKGIFLVVQLGFSIMVFLFLAAVNWYQGSELVSDRFDWNYTAKLSKLLNGIDAVSSPKQI
SQLDFFIYSAKHYPVMSALMIISFLYVLAALFLLIYSVKCNKQEIHLDC
NT seq 330 nt   +upstreamnt  +downstreamnt
gtgaagggaatatttttagttgttcagcttggattttctattatggtatttctgttttta
gctgctgttaattggtatcaaggaagcgagcttgtttcagatcgatttgattggaactat
actgctaaactctcaaaactgcttaatggaattgatgccgtcagcagccccaaacaaatt
tcacagcttgattttttcatctactccgctaaacactaccctgttatgagtgcgttaatg
atcatctccttcttatatgttctggccgctctttttttacttatatactcagtcaaatgc
aataagcaagagattcatttggactgctga

DBGET integrated database retrieval system