KEGG   Bacillus subtilis subsp. subtilis 168: BSU12080
Entry
BSU12080          CDS       T00010                                 

Gene name
ctaO
Definition
(RefSeq) protoheme IX farnesyltransferase
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU12080 (ctaO)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU12080 (ctaO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bsu01006]
    BSU12080 (ctaO)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU12080 (ctaO)
Enzymes [BR:bsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     BSU12080 (ctaO)
Prenyltransferases [BR:bsu01006]
 Compound prenylation
  Protoheme farnesyltransferase
   BSU12080 (ctaO)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU12080 (ctaO)
SSDB
Motif
Pfam: UbiA PseudoU_synth_1
Other DBs
NCBI-GeneID: 939825
NCBI-ProteinID: NP_389090
Pasteur: BG13183
BSORF: BG13183
UniProt: O31652 A0A6M4JH25
Position
complement(1279514..1280503)
AA seq 329 aa
MQFWGRRLFLENTRDSAAISETKYIKASNRVTIYDFIKLAKPGIIISNSIAAFGGFWIAF
ASAEKTLTGLAFLMTMVTAMLGTAFVMASGTVYNNYFDRHMDAKMARTRSRASVTGKMPP
AMILTYGSVLGIAGLAMLYSLNPLTAFLGLAAFIFYAIIYTVWVKRTSVWSTFVGSFPGA
APPLMGYCAVTGDFSMTAVLLYTIMFLWQPPHFWAIGIRRKEEYRAAGVPLLPVVKGNHV
TKIKMMQYIAVLVPVTLLFPFSLGTGHISPFYFLAALVLGGIWIKKSIKGFKTDDDVKWA
KDMFVYSLIYFCLLFFIMMIDSFMMFLIR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagttttgggggaggcgtctatttttggagaatacaagagattctgcagccatatct
gaaacaaaatacataaaagcttcgaaccgggtaaccatttacgattttatcaaacttgca
aagccgggcattatcatatcaaactcgatagcagccttcggcgggttttggatcgcgttt
gcaagcgcagaaaaaacgttaaccggcttggcttttttgatgacaatggtaacagcaatg
ttgggaaccgcgtttgtgatggcttccggcactgtctataacaactattttgatcggcat
atggacgcaaaaatggcacgaactcgcagcagggcctcggtcacagggaaaatgccgcca
gccatgatcttaacatatggctctgttttaggaatcgcaggtcttgccatgctttattcc
ctcaatccattaacggcctttctcggactggccgcctttattttttatgcgatcatctat
acggtatgggtgaaacgaacgtctgtgtggagcacatttgtcgggagcttcccaggagct
gcgccgccattgatggggtattgtgccgtaaccggtgacttcagtatgacagcagtgctg
ttgtacacgattatgtttctgtggcagccgccgcatttttgggcgattgggataagacgc
aaagaggaatatcgcgctgctggcgttccgctcttgccagtagtcaaaggcaatcatgta
acaaaaataaaaatgatgcaatatattgccgtcctggtgccggtcacgctattatttcct
ttctctctcggcaccggccatataagcccattttatttcttagccgccttggttctcgga
ggcatatggatcaaaaaaagcatcaaaggattcaaaacagacgatgacgtgaagtgggca
aaggatatgtttgtctactcgcttatttatttttgcttgctgttcttcatcatgatgatc
gattcatttatgatgtttctgatcagatga

DBGET integrated database retrieval system