KEGG   Bacillus subtilis subsp. subtilis 168: BSU12090
Entry
BSU12090          CDS       T00010                                 

Gene name
cotT
Definition
(RefSeq) spore coat protein
  KO
K06339  spore coat protein T
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU12090 (cotT)
SSDB
Other DBs
NCBI-GeneID: 939403
NCBI-ProteinID: NP_389091
Pasteur: BG10495
BSORF: BG10495
UniProt: P11863 A0A6M3Z9L7
Position
complement(1280626..1280949)
AA seq 107 aa
MNVHTPNLSIRNMVKGIKKAREVFLLDYPLNEQSFEQITPYDERQPYYYPRPRPPFYPPY
YYPRPYYPFYPFYPRPPYYYPRPRPPYYPWYGYGGGYGGGYGGGYGY
NT seq 324 nt   +upstreamnt  +downstreamnt
atgaatgtacatacacccaacttaagcatcaggaatatggtaaaaggaataaaaaaagct
agggaggttttcctcttggattaccctttgaatgaacagtcatttgaacaaattacccct
tatgatgaaagacagccttattattatccgcgtccgagaccgccattttatccgccttat
tattatccaagaccgtattatccgttctacccgttttatccgcgcccgccttattactac
ccgcgcccgcgaccgccttactacccttggtacggttacggcggaggttatggcggagga
tatgggggaggttacggttactag

DBGET integrated database retrieval system