KEGG   Bacillus subtilis subsp. subtilis 168: BSU12100
Entry
BSU12100          CDS       T00010                                 

Gene name
yjeA
Definition
(RefSeq) hypothetical protein
  KO
K22278  peptidoglycan-N-acetylglucosamine deacetylase [EC:3.5.1.104]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU12100 (yjeA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.104  peptidoglycan-N-acetylglucosamine deacetylase
     BSU12100 (yjeA)
SSDB
Motif
Pfam: Polysacc_deac_1 PdaC DUF3298 Polysacc_deac_2 UvrA_inter BTRD1 RELT
Other DBs
NCBI-GeneID: 936440
NCBI-ProteinID: NP_389092
Pasteur: BG13184
BSORF: BG13184
UniProt: O34798 A0A6M4JFF8
Position
1281128..1282531
AA seq 467 aa
MLAKRIKWFHVLIAVVCVVGLIGFFHNHSLKKETVMNKVRTDSQYGNVEIATLVNDGKTF
NYAVNYPVFKNEKMDSALKRFAEKEVRQFQKETKDVDQEHTTKRNELNVDYKIVHYAKQT
VAIVFNEYKYIGGAHGQTVKKTFNYDFSKQAFLSIDDIFKEDADYLHKLSLIAYHELKKN
KDIAADDALLKEGTAPKKENFSRFAIKEDYIELYFDTYQVAAGYLGEQSIAIKKSLLKDI
LKEQYIDKAKNKNKIKEQKPKHEVISLPKEETVDPNQKVIALTFDDGPNPATTNQILDSL
KKYKGHATFFVLGSRVQYYPETLIRMLKEGNEVGNHSWSHPLLTRLSVKEALKQINDTQD
IIEKISGYRPTLVRPPYGGINDELRSQMKMDVALWDVDPEDWKDRNKKTIVDRVMNQAGD
GRTILIHDIYRTSADAADEIIKKLTDQGYQLVTVSQLEEVKKQREAK
NT seq 1404 nt   +upstreamnt  +downstreamnt
ttgttggcaaaaagaatcaaatggtttcatgtattaatagcagttgtatgtgtggtgggc
cttatcggctttttccataatcattcattgaaaaaagaaacggtcatgaataaagtaaga
actgattctcaatatgggaatgttgagatcgcaacgcttgtgaatgacgggaaaactttt
aattacgcggtaaactatcctgttttcaaaaatgaaaaaatggattcggcattaaaaaga
ttcgcagaaaaagaggttcgtcaatttcaaaaggaaacaaaggacgttgaccaagagcat
acgacaaaacgcaacgaattaaatgttgattataaaattgtccattatgccaaacagaca
gtggcgattgtatttaatgaatataaatacatcggcggggcacacgggcaaaccgtgaaa
aaaacgtttaactatgattttagtaaacaagcgtttctttccattgatgatattttcaaa
gaggacgctgactacttacataagctttcgttaatcgcttatcacgagctgaaaaagaat
aaggacattgccgcggacgatgcactgttaaaggaagggacggctccgaaaaaagaaaat
ttcagccgctttgccatcaaggaggattatatcgaactttactttgacacatatcaggtt
gcagcaggctatcttggagagcaatcgattgccattaagaaaagtcttttgaaagacatt
ctgaaagaacaatatattgataaagcaaaaaataaaaataaaatcaaagaacaaaagccg
aagcatgaagtgatttctttacccaaagaggaaacagttgatccaaatcaaaaagtcatt
gcgcttactttcgacgacggcccgaatcctgcgacaacaaatcagattctagactccttg
aagaaatataagggtcatgccacgttttttgttttggggagcagagttcaatattatccg
gaaacgctaataagaatgctgaaagaaggaaatgaggttgggaaccattcatggagccat
ccgcttctcacaaggctttcagtgaaagaagcgttaaagcagatcaatgatacgcaagac
atcattgaaaaaataagcggatatcgtccgacgcttgtaagacccccatacggcggcatt
aatgatgaactgcggagtcaaatgaaaatggatgttgcgttatgggatgttgacccggaa
gattggaaagaccgtaacaaaaaaacaattgttgaccgtgtcatgaatcaggcgggagat
ggaagaaccattttgattcacgatatttaccgcacctctgctgatgcggccgatgaaatt
ataaaaaagctcaccgatcaaggctatcaattggtgacagtttctcagcttgaagaggtt
aaaaaacaaagagaagcgaaataa

DBGET integrated database retrieval system