KEGG   Bacillus subtilis subsp. subtilis 168: BSU12110
Entry
BSU12110          CDS       T00010                                 

Gene name
yjfA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2690 DUF6520 DUF1505
Other DBs
NCBI-GeneID: 939830
NCBI-ProteinID: NP_389093
Pasteur: BG13185
BSORF: BG13185
UniProt: O34554 A0A6M4JM51
Position
complement(1282571..1283044)
AA seq 157 aa
MKRLFMKASLVLFAVVFVFAVKGAPAKAETHAYDGKSPYYNDCASSGSTKKSSNLVNASN
QVIGVVELKFSSTCKTAWAKITMNNTLTSGYEANAEITRNTDGKRYNCDSAGGNGKAVAG
QKSCYTPMVYDLDPRTSYAFGKYSGPNLNVWATTGSY
NT seq 474 nt   +upstreamnt  +downstreamnt
ttgaaaagactgtttatgaaggcttcattggtgttattcgcagtagtatttgtttttgcc
gtcaaaggtgcacccgccaaggcggaaacccatgcctacgatggaaaaagcccttattac
aatgattgtgcgtccagcggctctacaaaaaaatcctcaaacttagtgaatgccagcaat
caagtcatcggagtagtcgagcttaaattcagcagtacatgtaaaacggcttgggcaaaa
atcacgatgaataatacattgacgtctggctatgaagcaaatgcggagattacccggaac
acagacggaaaaagatataattgtgattctgcaggcggcaatggaaaagcggtggccggc
caaaagtcttgctatacaccgatggtatatgatttagatccaaggacttcttacgctttc
ggcaagtattcaggaccaaacttaaatgtttgggccaccacaggctcttattaa

DBGET integrated database retrieval system