KEGG   Bacillus subtilis subsp. subtilis 168: BSU12120
Entry
BSU12120          CDS       T00010                                 

Gene name
yjfB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YjfB_motility
Other DBs
NCBI-GeneID: 936446
NCBI-ProteinID: NP_389094
Pasteur: BG13186
BSORF: BG13186
UniProt: O34438 A0A6M4JKN1
Position
complement(1283169..1283336)
AA seq 55 aa
MDIPALSVAMHQASLAQNVNIALTKKRLDTAQQNADQTLKMIQHPTLGQTIDVKA
NT seq 168 nt   +upstreamnt  +downstreamnt
atggatattcctgctttatcggttgcgatgcatcaagcatcccttgcccagaatgtaaat
attgctttaacgaaaaaaaggctggacaccgcccagcaaaatgccgatcaaaccttaaag
atgattcaacatccaactctcggacaaaccattgatgtaaaagcataa

DBGET integrated database retrieval system