KEGG   Bacillus subtilis subsp. subtilis 168: BSU12130
Entry
BSU12130          CDS       T00010                                 

Gene name
yjfC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2268 Peptidase_M57 DUF5700
Other DBs
NCBI-GeneID: 939398
NCBI-ProteinID: NP_389095
Pasteur: BG13187
BSORF: BG13187
UniProt: O34458 A0A6M3Z9Y9
Position
1283463..1284362
AA seq 299 aa
MNLVMEKTFEQYEKLFSMEEQKREDVFRYTMMRPFEKMWTAIQVPLKAKEPNGYDVIMAA
KMLGYLDVRDAESGQKALQILKESHVSETAESALRQCIFFAEREQLRVNAKEIKFGLYIA
DPNKLQLQKGYCGFGGIPGFIHVWINPNSYNLPRIPSIIAHEFHHNVRFSYIDFHHGSVS
VGDYLVIEGLAESFARELFGTERLGPWVTRFDHEDLQYSIDVINEVLDVKGFSEVSRYMF
GDPIANDQGFKPAGLSAFAGYAVGYHAVQSFMNQHHITISEATRLDAKTIISQCGLFST
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaatctagtaatggaaaagacctttgagcaatacgaaaagctgttttcaatggaagaa
cagaaaagagaagatgtatttcggtatacgatgatgaggccgtttgaaaagatgtggacc
gccatccaagttccgctgaaagcgaaggagccaaacggctatgatgtgatcatggctgcg
aaaatgctgggctatttggatgtccgtgatgctgaaagcggccagaaagcactacaaata
ctgaaagaatcacatgtttcagagacagctgaatctgcacttcggcaatgcatatttttt
gctgagcgcgaacagctgcgggtgaatgcaaaggagatcaaattcggcctttatatcgct
gatccaaataagcttcagctgcaaaaaggctactgcgggtttggcgggataccgggcttt
attcatgtatggattaatccgaacagttataacctgccaaggattccttccattattgct
catgagtttcatcataatgtgcggttttcgtatatagattttcatcatggctctgtaagt
gtcggggattatcttgtgattgaaggattggcggaatcattcgccagagagctgtttggt
acggaacgattgggcccttgggtaactcgttttgatcatgaagacttgcaatattccatt
gatgtgattaatgaggtgctggatgtgaaaggattttcggaagtcagccgttatatgttt
ggtgatccaattgctaacgaccaaggctttaagcctgcaggtttatcggcttttgcgggt
tatgcagttggctatcatgccgttcagtcatttatgaatcaacatcatatcacgataagc
gaggccacacgtttggatgcgaagaccattatttctcaatgcggtctgttttctacatga

DBGET integrated database retrieval system