KEGG   Bacillus subtilis subsp. subtilis 168: BSU12140
Entry
BSU12140          CDS       T00010                                 

Symbol
yjgA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2809
Other DBs
NCBI-GeneID: 939397
NCBI-ProteinID: NP_389096
Pasteur: BG13188
BSORF: BG13188
UniProt: O35027 A0A6M4JF79
Position
complement(1284371..1284769)
AA seq 132 aa
MKRNRWIYAVFTILIIGLGLGSRAFSSVLPDTLNTYLGDSLWAAMIFTGCGFLFRKLKTM
ITGIISLSFCFVIEFSQLYHAEWIDQIRDTSLGGLVLGYGFLWSDIEAYTIGIAACAAIE
LLVLGIKKRRCM
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaagcgaaatcgttggatatatgcagttttcaccatactgatcattgggctggggctt
ggatccagagcattctccagtgttcttcctgataccctcaatacttatctgggagactcg
ttgtgggccgccatgatcttcacgggatgcggatttctatttcggaagctgaagacaatg
ataacgggcattatcagtctttctttctgttttgtcattgaattcagccagctctatcat
gccgaatggatcgaccagattagagatacttctcttggcgggcttgtactagggtacggt
tttttatggagcgatatcgaagcatatacaatcggaattgccgcctgtgccgccatagaa
ctgctggttttgggaatcaaaaagcgccgctgtatgtga

DBGET integrated database retrieval system