KEGG   Bacillus subtilis subsp. subtilis 168: BSU12150
Entry
BSU12150          CDS       T00010                                 

Gene name
yjgB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4309 LPAM_1 SurE DUF4179
Other DBs
NCBI-GeneID: 936448
NCBI-ProteinID: NP_389097
Pasteur: BG13189
BSORF: BG13189
UniProt: O34960 A0A6M4JH68
Structure
PDB: 
4YGT

Position
complement(1284870..1285445)
AA seq 191 aa
MKKTMSAITAAAAVTSCFTGFGAASFSAPAKAAAQTNTLSENTNQSAAELVKNLYNTAYK
GEMPQQAQGLTINKSTKGDVHAAFGEPERPVGGDNRFDLYHWNMGQPGYGFSYHKDMTIS
EIRYFGTGVERQLNLGGVTPEVLQKQLGPVNRVLTVPFTDEIDYVYDTGRYELHFVIGTD
QTADHVNLKAK
NT seq 576 nt   +upstreamnt  +downstreamnt
atgaaaaagacaatgtctgctataaccgcggcagcagcagtaacaagctgttttaccggc
tttggggctgcgtccttttcagcaccggcaaaggccgcagctcaaacaaacacactctca
gaaaacacgaatcaatcagccgctgagcttgtcaaaaacctctataacaccgcctataaa
ggggaaatgcctcagcaggcgcaaggccttaccattaacaaaagcacaaaaggggatgtc
cacgctgcgtttggggaaccggaaagaccagtcgggggagacaatcgatttgatttatat
cactggaatatgggacagccgggctacggattttcctatcataaagacatgacaatttca
gaaatccgctactttggaaccggtgtggaacggcagctgaatttaggcggagttacgccg
gaagtgctgcagaagcaattaggaccagtaaatcgggtgttaaccgtcccgtttaccgat
gaaatcgattatgtatatgatacaggccgctatgaactccattttgtaataggcacggat
cagacagccgaccatgtaaacctaaaagcaaaataa

DBGET integrated database retrieval system