KEGG   Bacillus subtilis subsp. subtilis 168: BSU12160
Entry
BSU12160          CDS       T00010                                 

Gene name
yjgC
Definition
(RefSeq) oxidoreductase
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu00680  Methane metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU12160 (yjgC)
  09102 Energy metabolism
   00680 Methane metabolism
    BSU12160 (yjgC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     BSU12160 (yjgC)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 Fer2_4 Fer4 NADH-G_4Fe-4S_3 Fer4_10 Fer4_21 Fer4_7 Fer4_6 Fer4_8 Fer4_2 Fer4_9 Fer2_3 Fer4_15 Fer4_16 TPP_enzyme_M
Other DBs
NCBI-GeneID: 939396
NCBI-ProteinID: NP_389098
Pasteur: BG13190
BSORF: BG13190
UniProt: O34720
Position
1285591..1288548
AA seq 985 aa
MAGKKTITINGVEMEASEEQTVLQLLNNSSIEVPQVCYHPSLGPIETCDTCIVSINGELK
RSCSAELKDGDVIDTLSPDVKKAQVIGMDKILYNHELYCTVCDYNNGGCEIHNTVKEMKI
NHQSIPFDHKPYHKDESHPFYRYDPDQCILCGRCVEACQDVQVTETLTIDWERKRPRVIW
DNDVPINESSCVSCGHCSTVCPCNAMMEKGMEGEAGYLTGINNETLRPMIEITKGVETGY
GSILAISDMESAMRDERIKKTKTVCTYCGVGCSFDVWTKGRDILKVEPQEEAPANGISTC
VKGKFGWDFVNSEERLTKPLIREGDHFREAEWEEALLLIASKFTELKEAFGPDSLAFITS
SKCTNEESYLMQKLARGVIGTNNVDNCSRYCQSPATAGLFRTVGYGGDSGSITDIAQADL
VLIIGSNTSESHPVLSTRIKRAHKLRGQKVIVADIRKHEMAERSDLFVQPRAGSDIVWLN
AIAKYLIENGKADERFLRERVNGRDEYVKSLAPYTLEYAEEKTGIDQETLIQMAEMIGQA
DSVCALWAMGVTQHIGGSDTSTAISNLLLVTGNYGKPGAGSYPLRGHNNVQGASDFGSMP
DRLPGYEKVTDEQVRQKYERVWGVPLPKEPGMTNHEMIEKIHSGQLKAMYVKGEEMGLVD
SNINHVHAAYEKLDFFVVQDIFLSRTAEFADVVLPASPSLEKEGTFTNTERRIQRLYQVF
EPLGESKPDWQIIMEVANKLGAGWLYEHPADIMEEAAKLSPIYAGVTYERLEGYNSLQWP
VNADGKDSPLLFTERFPFPDGKAILYPVQWTEPKEFGEEYDIHVNNGRLLEHFHEGNLTY
KSKGISEKTPEVFLEISPELAAERGIQDGTLVRLTSPFGNVKVKCLITDRVKGKEVYLPM
NDSGEAAINLLTGSHADKDTDTPAYKETSAKMEILKHDGISPLPKINHRNGNPQPQIGVQ
VHKKWARKDYIFPGDAVKRGMGHNG
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggctggcaagaaaacaatcacaataaacggcgttgaaatggaagcgtccgaggaacag
acggtgctgcagcttttgaataacagctcgattgaagtgccgcaagtttgctatcatcca
agcttagggccgattgagacatgtgatacgtgcatcgtcagcatcaatggtgagctgaag
aggtcgtgctccgctgaattaaaggatggggatgtcattgatacgctctcacctgacgtg
aaaaaagcgcaggtcatcgggatggacaagattttatataatcatgagctttattgtaca
gtttgcgattacaacaatgggggatgcgaaatacataatacggtgaaggaaatgaaaatc
aatcaccaaagcattccgtttgatcacaagccataccataaggatgaatcccatccgttt
tatcggtatgatccagatcaatgtatattgtgcggacgctgtgttgaggcatgccaagac
gttcaggtaactgaaacgctgaccattgactgggagcggaaacgcccgcgcgtcatttgg
gataacgacgtgccgatcaatgagtcgtcatgtgtgtcatgcggccattgttcaacggtc
tgtccgtgcaacgcgatgatggaaaaaggaatggaaggggaagccggatatttaacaggc
atcaataacgaaacgctgcgaccgatgatcgagatcacgaaaggcgtagagacaggctac
ggctcgattctcgcgatttctgatatggaatcggccatgcgtgatgaacgaatcaaaaaa
acgaaaaccgtctgcacgtattgcggcgtcggctgcagctttgatgtctggacaaagggc
agagacattctgaaagtagagccgcaggaggaagcgcctgccaacggcatttctacttgt
gtgaaaggcaagttcggctgggatttcgttaacagcgaagaacgcctgacaaagccgctg
atccgtgaaggcgatcatttccgtgaagcagagtgggaggaggcgttattgctgatcgcc
agcaagttcactgaattaaaagaggcgtttggcccggattctctcgcttttattacatct
tctaaatgtacaaatgaagaatcctatcttatgcaaaagctggccagaggggtcattggc
acaaataatgtggacaactgctctcgctattgccaatctcctgcgactgccggcctgttc
cggacagtcggctatggcggtgattcaggatcaattacagatatcgcgcaagcggacctt
gttttgattatcggttcgaacacgtctgagtcgcatccagtcttatccactcggattaaa
cgggctcataagctgagagggcagaaagtgatcgtcgcggatatcagaaagcacgaaatg
gcagagcgctcagatttatttgtccagccgcgtgccggatcggatatcgtctggctgaat
gcgatcgccaaatatttaatagaaaacggcaaggccgatgaacgatttttgagagaaaga
gtgaacggacgggatgaatatgtaaaaagcctcgcgccgtacacacttgaatatgctgag
gagaaaaccgggattgatcaagaaacccttatccaaatggcagagatgatcgggcaagct
gacagtgtgtgcgcattgtgggcgatgggcgtgacacagcatattggaggaagcgacacg
agcacggcgatctctaatctgctgcttgtgacaggaaactacggaaaaccgggagcaggt
tcttacccattgcgcggccataacaacgtgcagggagcaagtgactttgggagtatgcct
gacagactaccgggctatgaaaaagtgacggacgaacaagtccgccaaaaatacgagcgt
gtgtggggtgtgccgctgccgaaggagccgggtatgaccaaccacgaaatgattgaaaaa
atccattccggacagttgaaagcgatgtatgtaaaaggtgaagaaatgggccttgtcgac
tccaatatcaatcatgtacacgctgcatatgaaaagcttgatttctttgtggtgcaggac
attttcctttcacgtacagcggagtttgctgatgtggttcttcctgcgagcccgagcctt
gaaaaagaaggaacgtttacaaacacagaacgccggattcagcgtttgtatcaggtattt
gaaccgctgggtgaatcaaagccggattggcagattattatggaggttgccaataagctt
ggcgccggctggctctatgagcatcctgcagacattatggaggaagcagccaagctgtcg
ccgatttatgccggtgtcacctatgaacgtcttgagggctataattccctgcaatggcct
gtaaacgctgatggaaaggattcgcctttactctttacagagcgcttccctttcccagac
ggcaaggccattctctaccctgtccagtggacagagcctaaggaattcggtgaggaatat
gatatccatgtcaacaatgggcggctcttggagcacttccacgaagggaacctgacttac
aaatcaaaagggatttcggagaaaacaccggaagtgttcttagaaatttctcctgagctt
gcggcagaacgagggattcaggacggaaccctcgtcagactcacatcgcctttcggaaat
gtcaaagtgaagtgcctgattactgatcgagtcaaagggaaggaagtatatctgccaatg
aacgattcaggggaagcggcgatcaacctgttaacaggcagccatgccgataaggatacc
gatacgcctgcttacaaagaaacatcggccaagatggaaattttgaagcacgacggaatc
agcccgctgcctaagatcaaccaccgcaacggcaatccgcagccgcaaatcggtgtgcag
gttcataagaaatgggcgcggaaggattatattttccctggtgacgctgtgaaaaggggg
atgggccataatggctaa

DBGET integrated database retrieval system