KEGG   Bacillus subtilis subsp. subtilis 168: BSU12170
Entry
BSU12170          CDS       T00010                                 

Gene name
yjgD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1641
Other DBs
NCBI-GeneID: 939826
NCBI-ProteinID: NP_389099
Pasteur: BG13191
BSORF: BG13191
UniProt: O34681 A0A6M3ZA06
Position
1288541..1289101
AA seq 186 aa
MAKAIKRIQKIEVTEEDQRKRDLREIEDALIDHKEAILETLHMLGHMNERGVLPLLRGLF
GQGDKVLDILVKKADTEETANTLKNLLLLFGTLGMLDVKQLEPLILKVNAGVASAVEQKN
SEEKTGYFDIIRSLKDPEINKSITLLFSFLKGMGQDTKELERTTQPPEHQKHHQEPREKR
GMNKRD
NT seq 561 nt   +upstreamnt  +downstreamnt
atggctaaagcgattaaacgaatccaaaaaatcgaggtaacagaagaggatcagcgaaag
cgtgatttgcgggaaattgaagatgctctaattgaccacaaagaagcgattctcgaaaca
ttgcatatgctgggccatatgaacgagcgcggggtcctgccgttgctccgcggccttttt
ggtcaaggggataaagttcttgatatcctggtgaaaaaggcagatacagaggaaacagcc
aatacgctgaaaaatctgcttcttctgtttggaacactcggcatgctggacgtgaagcag
ctggagcctctcattttgaaagtgaatgcgggtgtggcaagcgctgtagagcagaaaaac
agtgaagaaaagacaggttattttgatattatccgctcgctaaaagacccggaaatcaac
aaatcaattacactgctcttttcctttttaaaaggaatgggacaagatacaaaggagctg
gaacgcacgacgcagcctccggaacaccaaaaacatcatcaggaaccccgagagaaaaga
ggaatgaataagcgagattga

DBGET integrated database retrieval system