KEGG   Bacillus subtilis subsp. subtilis 168: BSU12180
Entry
BSU12180          CDS       T00010                                 

Gene name
yjhA
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4352 LETM1 O-antigen_lig LPAM_1
Other DBs
NCBI-GeneID: 936457
NCBI-ProteinID: NP_389100
Pasteur: BG13192
BSORF: BG13192
UniProt: O34725 A0A6M3Z9V3
Structure
PDB: 
3CFU

Position
1289298..1289939
AA seq 213 aa
MKKVLLLLFVLTIGLALSACSQSSDASEKEKPKEKKSQEELEKELDKELKKGGEPKTKKD
DQIHKIGETFKAGHTNFTVNKVDRVQKGEYMNVGGAVNEETKTIKDDEERLIIEVTMENI
GEDSISYNFIGFDLRDKNDQSVRPVFSIEEKGRILMGGTLVSGKKVTGVLSYVIPKGEQK
HYTLVYNPFLADTNSSNTEERVKDDIDYLVKLD
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaaaaaagtcttattactattatttgtcttgacgatcgggttagcgctttctgcgtgc
agccaatcgagcgatgcgtcagagaaggaaaaaccgaaagagaaaaaatcgcaagaagag
cttgaaaaggaacttgataaggaattgaaaaaaggcggtgagccgaagaccaaaaaagat
gatcaaatacataaaataggagaaacatttaaagcaggacatacgaattttacagtgaat
aaagttgatagagtgcaaaaaggtgaatatatgaatgttggcggagctgtaaatgaggag
acaaaaacaataaaagatgatgaggaacggcttattatagaagttacgatggaaaatata
ggggaagattcaataagctacaattttatcgggtttgatttaagagataagaatgatcaa
tcagtgcggcctgttttttctatagaagagaagggcagaatccttatgggaggaacacta
gtatcggggaaaaaggttacaggtgtactcagttatgtcatccctaaaggagaacagaaa
cattacacactggtatataatccgtttttagctgatacaaatagcagtaatacagaagag
agagtaaaggacgatattgattacttggtgaagttagattag

DBGET integrated database retrieval system