KEGG   Bacillus subtilis subsp. subtilis 168: BSU12190
Entry
BSU12190          CDS       T00010                                 

Gene name
yjhB
Definition
(RefSeq) ADP-ribose pyrophosphatase YjhB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Nudix_N NUDIX
Other DBs
NCBI-GeneID: 939419
NCBI-ProteinID: NP_389101
Pasteur: BG13193
BSORF: BG13193
UniProt: C0SPC3 A0A6M4JIV5
Position
1290018..1290644
AA seq 208 aa
MIKVQTKWLERAQRIRAIAQAGLAFSKDVYDRERYEELMKLSAEMMADYSEKDIEVITDL
WQGEKGYPTPKADVRGAVFRENQILLVREKHDELWSLPGGFCEIGLSPAENVVKEIKEES
GYDTEPSRLLAVLDSHKHSHPPQPYHYYKIFIACSMTDGQGETGIETNHAAFFPEDRLPP
LSPKRNTPSQLSMLFDFLRHPDKKTIFD
NT seq 627 nt   +upstreamnt  +downstreamnt
gtgataaaagtgcaaaccaaatggctggaacgggcacagcggattcgggcgatcgcccaa
gcggggcttgctttttccaaggatgtgtacgacagggagaggtacgaagagctaatgaag
cttagcgcggaaatgatggcggattactcggagaaggacattgaagttatcactgattta
tggcaaggcgagaagggctatccaacaccgaaagcggatgttcgcggcgctgtattcaga
gagaatcagattttgcttgtccgggagaagcatgatgagctgtggtcgctgccgggcgga
ttttgcgagattggtttatcgccggctgaaaacgttgtcaaggaaatcaaagaagagtcg
gggtacgatacagagccgtctcgattgctggccgtgctagacagccataaacactctcat
ccccctcagccttatcactattataaaatcttcatcgcatgcagcatgacggacgggcag
ggggaaacagggatcgagacgaatcatgccgctttttttccggaagacagactcccgccg
ctttctcctaaacgaaacacaccctcacagcttagcatgctgtttgactttttgcgccat
ccggacaagaaaacgatatttgactaa

DBGET integrated database retrieval system