KEGG   Bacillus subtilis subsp. subtilis 168: BSU12200
Entry
BSU12200          CDS       T00010                                 

Gene name
yjiA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2613 MT0933_antitox
Other DBs
NCBI-GeneID: 939399
NCBI-ProteinID: NP_389102
Pasteur: BG13194
BSORF: BG13194
UniProt: O34679 A0A6M3Z9N0
Position
complement(1290675..1290953)
AA seq 92 aa
MAAQTDYKKQVVGILLSLAFVLFVFSFSERHEKPLVEGKKQENWHTVVDKASVKIYGSRL
VEENKLKQKLGHKQADSILTLLKLANEKHITL
NT seq 279 nt   +upstreamnt  +downstreamnt
gtggcagcacagactgattacaaaaaacaagttgtcggaatcctactttcacttgcattc
gtactctttgtgttctctttttctgagagacatgaaaaaccgcttgttgagggaaaaaaa
caggaaaactggcatactgtcgtcgacaaagcctccgtcaaaatttatggcagccgatta
gttgaagaaaacaaattaaagcaaaaactcggccataaacaagccgattctattttgacc
cttctgaaactcgccaacgaaaaacacattacattataa

DBGET integrated database retrieval system