KEGG   Bacillus subtilis subsp. subtilis 168: BSU12210
Entry
BSU12210          CDS       T00010                                 

Gene name
yjiB
Definition
(RefSeq) cytochrome P450 YjiB
  KO
K23138  cytochrome P450 family 109 [EC:1.14.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsu00199]
    BSU12210 (yjiB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     BSU12210 (yjiB)
Cytochrome P450 [BR:bsu00199]
 Cytochrome P450, bacteria type
  CYP109 family
   BSU12210 (yjiB)
SSDB
Motif
Pfam: p450 Lbh
Other DBs
NCBI-GeneID: 936452
NCBI-ProteinID: NP_389103
Pasteur: BG13195
BSORF: BG13195
UniProt: O34374 A0A6M3Z9L6
Structure
PDB: 
4RM4

Position
1291344..1292534
AA seq 396 aa
MNVLNRRQALQRALLNGKNKQDAYHPFPWYESMRKDAPVSFDEENQVWSVFLYDDVKKVV
GDKELFSSCMPQQTSSIGNSIINMDPPKHTKIRSVVNKAFTPRVMKQWEPRIQEITDELI
QKFQGRSEFDLVHDFSYPLPVIVISELLGVPSAHMEQFKAWSDLLVSTPKDKSEEAEKAF
LEERDKCEEELAAFFAGIIEEKRNKPEQDIISILVEAEETGEKLSGEELIPFCTLLLVAG
NETTTNLISNAMYSILETPGVYEELRSHPELMPQAVEEALRFRAPAPVLRRIAKRDTEIG
GHLIKEGDMVLAFVASANRDEAKFDRPHMFDIRRHPNPHIAFGHGIHFCLGAPLARLEAN
IALTSLISAFPHMECVSITPIENSVIYGLKSFRVKM
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgaatgtgttaaaccgccggcaagccttgcagcgagcgctgctcaatgggaaaaacaaa
caggatgcgtatcatccgtttccatggtatgaatcgatgagaaaggatgcgcctgtttcc
tttgatgaagaaaaccaagtgtggagcgtttttctttatgatgatgtcaaaaaagttgtt
ggggataaagagttgttttccagttgcatgccgcagcagacaagctctattggaaattcc
atcattaacatggacccgccgaagcatacaaaaatccgttcagtcgtgaacaaagccttt
actccgcgcgtgatgaagcaatgggaaccgagaattcaagaaatcacagatgaactgatt
caaaaatttcaggggcgcagtgagtttgaccttgttcacgatttttcatacccgcttccg
gttattgtgatatctgagctgctgggagtgccttcagcgcatatggaacagtttaaagca
tggtctgatcttctggtcagtacaccgaaggataaaagtgaagaagctgaaaaagccttt
ttggaagaacgagataagtgtgaggaagaactggccgcgttttttgccggcatcatagaa
gaaaagcgaaacaaaccggaacaggatattatttctattttagtggaagcggaagaaaca
ggcgagaagctgtccggtgaagagctgattccgttttgcacgctgctgctggtggccgga
aatgaaaccactacaaacctgatttcaaatgcgatgtacagcatattagaaacgccaggc
gtttacgaggaactgcgcagccatcctgaactgatgcctcaggcagtggaggaagccttg
cgtttcagagcgccggccccggttttgaggcgcattgccaagcgggatacggagatcggg
gggcacctgattaaagaaggtgatatggttttggcgtttgtggcatcggcaaatcgtgat
gaagcaaagtttgacagaccgcacatgtttgatatccgccgccatcccaatccgcatatt
gcgtttggccacggcatccatttttgccttggggccccgcttgcccgtcttgaagcaaat
atcgcgttaacgtctttgatttctgcttttcctcatatggagtgcgtcagtatcactccg
attgaaaacagtgtgatatacggattaaagagcttccgtgtgaaaatgtaa

DBGET integrated database retrieval system