KEGG   Bacillus subtilis subsp. subtilis 168: BSU12220
Entry
BSU12220          CDS       T00010                                 

Gene name
yjiC
Definition
(RefSeq) UDP-glucosyltransferase YjiC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyco_tran_28_C UDPGT Glyco_transf_28 Glyco_trans_1_3 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_2 ER_lumen_recept
Other DBs
NCBI-GeneID: 939402
NCBI-ProteinID: NP_389104
Pasteur: BG13196
BSORF: BG13196
UniProt: O34539 A0A6M3Z9N5
Position
1292557..1293735
AA seq 392 aa
MKKYHISMINIPAYGHVNPTLALVEKLCEKGHRVTYATTEEFAPAVQQAGGEALIYHTSL
NIDPKQIREMMEKNDAPLSLLKESLSILPQLEELYKDDQPDLIIYDFVALAGKLFAEKLN
VPVIKLCSSYAQNESFQLGNEDMLKKIREAEAEFKAYLEQEKLPAVSFEQLAVPEALNIV
FMPKSFQIQHETFDDRFCFVGPSLGERKEKESLLIDKDDRPLMLISLGTAFNAWPEFYKM
CIKAFRDSSWQVIMSVGKTIDPESLEDIPANFTIRQSVPQLEVLEKADLFISHGGMNSTM
EAMNAGVPLVVIPQMYEQELTANRVDELGLGVYLPKEEVTVSSLQEAVQAVSSDQELLSR
VKNMQKDVKEAGGAERAAAEIEAFMKKSAVPQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaaaaagtaccatatttcgatgatcaatatcccggcgtacggacatgtcaatcctacg
cttgctttagtagagaagctttgtgagaaagggcaccgtgtcacgtacgcgacgactgag
gagtttgcgcccgctgttcagcaagccggtggagaagcattgatctatcatacatccttg
aatattgatcctaagcaaatcagggagatgatggaaaagaatgacgcgcccctcagcctt
ttgaaagaatcactcagcattctgccgcagcttgaggagttatataaggatgatcagcct
gatctgatcatctatgactttgttgcgctggctggtaaattgtttgctgaaaagcttaat
gttccggtcattaagctctgttcgtcatatgcccaaaatgaatcctttcagttaggaaat
gaagacatgctgaaaaaaataagagaagcagaggctgaatttaaagcctacttggagcaa
gagaagttgccggctgtttcatttgaacagttagctgtgccggaagcattaaatattgtc
tttatgccgaagtcttttcagattcagcatgagacgttcgatgaccgtttctgttttgtc
ggcccctctctcggagaacggaaggaaaaagaaagcctgttgattgacaaggatgatcgc
ccgcttatgctgatttctttgggtacggcgtttaacgcatggccggaattttacaagatg
tgcatcaaggcatttcgggattcttcatggcaagtgatcatgtcggttgggaaaacgatt
gatccagaaagcttggaggatattcctgctaactttaccattcgccaaagtgtgccgcag
cttgaggtgttagagaaagctgatttgttcatctctcatggcgggatgaacagtacgatg
gaagcgatgaacgcaggtgtgccgcttgtcgtcattccgcaaatgtatgagcaggagctc
actgcaaatcgggttgatgaattaggccttggcgtttatttgccgaaagaggaagtgact
gtttccagcctgcaggaagcggttcaggctgtatccagtgatcaagagctgctcagccgc
gtcaagaatatgcaaaaggatgtaaaagaagctggcggagcggagcgtgcggcagctgag
attgaagcgtttatgaaaaaatccgctgtcccgcagtaa

DBGET integrated database retrieval system