KEGG   Bacillus subtilis subsp. subtilis 168: BSU12220
Entry
BSU12220          CDS       T00010                                 
Symbol
yjiC
Name
(RefSeq) UDP-glucosyltransferase YjiC
  KO
K25230  NDP-glycosyltransferase [EC:2.4.1.384]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU12220 (yjiC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.384  NDP-glycosyltransferase
     BSU12220 (yjiC)
SSDB
Motif
Pfam: EryCIII-like_C Glyco_tran_28_C UDPGT EryCIII-like_N Glyco_transf_28 Glyco_trans_1_3 Glyco_transf_4 Glyco_trans_1_4 ER_lumen_recept
Other DBs
NCBI-GeneID: 939402
NCBI-ProteinID: NP_389104
Pasteur: BG13196
UniProt: O34539 A0A6M3Z9N5
Structure
Position
1292557..1293735
AA seq 392 aa
MKKYHISMINIPAYGHVNPTLALVEKLCEKGHRVTYATTEEFAPAVQQAGGEALIYHTSL
NIDPKQIREMMEKNDAPLSLLKESLSILPQLEELYKDDQPDLIIYDFVALAGKLFAEKLN
VPVIKLCSSYAQNESFQLGNEDMLKKIREAEAEFKAYLEQEKLPAVSFEQLAVPEALNIV
FMPKSFQIQHETFDDRFCFVGPSLGERKEKESLLIDKDDRPLMLISLGTAFNAWPEFYKM
CIKAFRDSSWQVIMSVGKTIDPESLEDIPANFTIRQSVPQLEVLEKADLFISHGGMNSTM
EAMNAGVPLVVIPQMYEQELTANRVDELGLGVYLPKEEVTVSSLQEAVQAVSSDQELLSR
VKNMQKDVKEAGGAERAAAEIEAFMKKSAVPQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaaaaagtaccatatttcgatgatcaatatcccggcgtacggacatgtcaatcctacg
cttgctttagtagagaagctttgtgagaaagggcaccgtgtcacgtacgcgacgactgag
gagtttgcgcccgctgttcagcaagccggtggagaagcattgatctatcatacatccttg
aatattgatcctaagcaaatcagggagatgatggaaaagaatgacgcgcccctcagcctt
ttgaaagaatcactcagcattctgccgcagcttgaggagttatataaggatgatcagcct
gatctgatcatctatgactttgttgcgctggctggtaaattgtttgctgaaaagcttaat
gttccggtcattaagctctgttcgtcatatgcccaaaatgaatcctttcagttaggaaat
gaagacatgctgaaaaaaataagagaagcagaggctgaatttaaagcctacttggagcaa
gagaagttgccggctgtttcatttgaacagttagctgtgccggaagcattaaatattgtc
tttatgccgaagtcttttcagattcagcatgagacgttcgatgaccgtttctgttttgtc
ggcccctctctcggagaacggaaggaaaaagaaagcctgttgattgacaaggatgatcgc
ccgcttatgctgatttctttgggtacggcgtttaacgcatggccggaattttacaagatg
tgcatcaaggcatttcgggattcttcatggcaagtgatcatgtcggttgggaaaacgatt
gatccagaaagcttggaggatattcctgctaactttaccattcgccaaagtgtgccgcag
cttgaggtgttagagaaagctgatttgttcatctctcatggcgggatgaacagtacgatg
gaagcgatgaacgcaggtgtgccgcttgtcgtcattccgcaaatgtatgagcaggagctc
actgcaaatcgggttgatgaattaggccttggcgtttatttgccgaaagaggaagtgact
gtttccagcctgcaggaagcggttcaggctgtatccagtgatcaagagctgctcagccgc
gtcaagaatatgcaaaaggatgtaaaagaagctggcggagcggagcgtgcggcagctgag
attgaagcgtttatgaaaaaatccgctgtcccgcagtaa

DBGET integrated database retrieval system