KEGG   Bacillus subtilis subsp. subtilis 168: BSU12229
Entry
BSU12229          CDS       T00010                                 

Gene name
yjzI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 8302936
NCBI-ProteinID: YP_003097710
UniProt: C0H3Z3 A0A6M4JF36
Position
complement(1293776..1293964)
AA seq 62 aa
METKKEEYETKGYDTSIVYEFNEYPDARSGRCDNCDYTLFKSSVKGGKFLRECRRCGMKK
NI
NT seq 189 nt   +upstreamnt  +downstreamnt
atggaaaccaaaaaagaagaatatgaaacaaaaggctacgatacatcgattgtttacgaa
ttcaatgaatatccggatgcccgcagcgggcgctgcgacaactgtgattacacactgttc
aaaagctctgtaaaaggcggaaaatttcttagagaatgccggagatgcgggatgaaaaaa
aatatttaa

DBGET integrated database retrieval system