KEGG   Bacillus subtilis subsp. subtilis 168: BSU12230
Entry
BSU12230          CDS       T00010                                 

Gene name
hemD
Definition
(RefSeq) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00860  Porphyrin and chlorophyll metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01240  Biosynthesis of cofactors
Module
bsu_M00846  Siroheme biosynthesis, glutamyl-tRNA => siroheme
bsu_M00926  Heme biosynthesis, bacteria, glutamyl-tRNA => coproporphyrin III => heme
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSU12230 (hemD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSU12230 (hemD)
SSDB
Motif
Pfam: HEM4 Oxidored_nitro
Other DBs
NCBI-GeneID: 939823
NCBI-ProteinID: NP_389105
Pasteur: BG13197
BSORF: BG13197
UniProt: O34394 A0A6M3Z9Z9
Position
1294138..1294950
AA seq 270 aa
MGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQHIPPEEETVE
RLCRELMNDEVDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggaaaagggttacttggaaaacgcgtggcaatcggtggctcacgaaaaacggaagaa
attagtacaatcattgaaaaacagggcggaatacctgtcatccggcctctccaaggtaca
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgcggaagaaaaagct
gactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagagaaa
attggactgaaagatgagtttctgcaggccattcgccaagcgaaagcggcatgccgggga
tacaaaacgctgtctgcgctgaaaaagcttggaatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttccttggagcctcacgacttttcaggaaaaacagtc
atggtgcagcttcatggcgaaaaagcgccggctctcatggcatttcttgaagaaaaaggc
gcgtctgtcctgccgattctgccttatcagcacatcccgccggaggaggaaacggtggag
cggttatgccgagagctgatgaacgatgaggtcgatgccgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccaaggggcgaggttatatcaatgaagtgaagaag
gtattcgaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactgcgg
gaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgattgtt
gagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system