KEGG   Bacillus subtilis subsp. subtilis 168: BSU12240
Entry
BSU12240          CDS       T00010                                 

Gene name
yjkA
Definition
(RefSeq) hypothetical protein
  KO
K02069  UDP-glucose/iron transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12240 (yjkA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   UDP-glucose/iron transporter
    BSU12240 (yjkA)
SSDB
Motif
Pfam: UPF0014 COX2-transmemb
Other DBs
NCBI-GeneID: 936453
NCBI-ProteinID: NP_389106
Pasteur: BG13198
BSORF: BG13198
UniProt: O34684 A0A6M4JH75
Position
complement(1294996..1295748)
AA seq 250 aa
MDYLSLSLTMIFVLIALFLSKSFKAGVEKDMIIATIRAAVQLLIIGYVLSLIFRGDHPVF
ILLMVLLMLAVAAQNVIKRKKNTIGSFWRVFAALAIVEIVTQGILLSLHIIPLTARYVIP
ISGMVIGNSMVLSSLFLNRLNSEVGVRKEEIQLILSLGGTPKQSIQRILTSAMKMSMIPT
LESQKTLGLVQLPGMMTGQILAGADPIQAVRFQLLIVFTTMASAALTCVILSVLTYPSLF
TVHQQLKQNE
NT seq 753 nt   +upstreamnt  +downstreamnt
atggattacctttctctctctttaacgatgatctttgttttgatcgccttgtttttatca
aaatcctttaaagccggtgtagaaaaagacatgatcatcgccaccatccgggccgcggtg
cagctgcttatcatcggttatgttttgtcgctgatttttcgcggagaccaccctgttttt
atcctgctgatggtgctgttaatgctcgcggtggcggcgcaaaatgtcatcaagcgaaag
aaaaatactatcggttcgttttggagggtgtttgccgcgttagcaatcgtagaaattgtg
acgcagggaattctgctgtctcttcatatcattccgcttacggcacgatatgtcattccg
atcagcgggatggtcatcggaaattcgatggtgctctcaagtttgtttctaaaccggctt
aactcagaagtcggcgttcgcaaagaagaaattcaattaatattgtcacttggcggcaca
ccgaagcaatccatacagcgcattcttacctcagcgatgaaaatgagtatgatcccgacg
ctcgaaagccagaaaacactgggtcttgtccagcttcccggcatgatgactggccagatt
ctagccggcgcggacccgattcaggcagtacgctttcaactcttaatcgtgtttacaacg
atggcctcagccgcgctgacttgtgtaatcttaagcgtgctgacatacccatcattattc
accgttcatcagcagctgaagcaaaatgaatga

DBGET integrated database retrieval system