KEGG   Bacillus subtilis subsp. subtilis 168: BSU12250
Entry
BSU12250          CDS       T00010                                 

Gene name
yjkB
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K02068  UDP-glucose/iron transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12250 (yjkB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   UDP-glucose/iron transporter
    BSU12250 (yjkB)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_16 AAA_21 AAA_29 NB-ARC DO-GTPase2 AAA_22 RsgA_GTPase AAA AAA_24 ATPase_2 AAA_23 AAA_30 G-alpha AAA_25 FtsK_SpoIIIE Spore_III_AA NACHT
Other DBs
NCBI-GeneID: 939401
NCBI-ProteinID: NP_389107
Pasteur: BG13199
BSORF: BG13199
UniProt: O34756 A0A6M3ZA94
Position
complement(1295748..1296500)
AA seq 250 aa
MEANDQTQNIPAISFRSVRKSYKQDGQTYDVLQDVTGDIQQGAIVAVLGPSGSGKSTLLS
MCNLMRTPDSGEVNIYGKEVREWNVNELRRTAALAFQSAPVLDGTVRDNLSLVQRLHQSQ
LYSPEKLASLAGLPPELLDRSARDLSGGQRQRLSLARTLSNPSSILLLDEITSALDPVSA
LEIEELIKRQHQEKKWTVMWVTHNMEQAKRIADTIWFMADGRLLEIAETDTFFSAPQHEA
AKEFLKGGTR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggaagcaaacgatcaaacacaaaacataccagccatctccttcagatcagtcagaaaa
agctataaacaagatggacaaacctatgatgtgctgcaggatgtcaccggagacattcaa
cagggtgcaatcgtagccgttttaggcccttccggctcaggcaaaagcaccctcctttct
atgtgtaatttaatgagaacgcctgacagcggcgaagtcaacatatacggaaaggaagtc
agagaatggaatgtcaatgagctgaggcgaacggcagccctcgcgtttcaatcggctccc
gtgctcgacgggacagtgcgtgacaatttaagtcttgtacaaaggctgcatcaatcccag
ctgtactctcctgaaaagctggcttcgcttgcagggctgccgccagagttgttagacaga
agcgccagagacttatcgggcgggcagcggcaaagactgtcactggccagaacgctctca
aatccttcctccattctattgttggacgaaatcacatcggccttggacccggtctctgct
cttgagattgaagaactgatcaaacgtcagcatcaagagaaaaaatggacagtcatgtgg
gtcactcataatatggagcaggcaaaacgaatagccgataccatttggtttatggcagat
ggccggctgcttgaaatcgctgaaaccgacacatttttctccgctccgcagcatgaagca
gcgaaagaatttttgaagggaggcactcggtaa

DBGET integrated database retrieval system