KEGG   Bacillus subtilis subsp. subtilis 168: BSU12260
Entry
BSU12260          CDS       T00010                                 

Symbol
yjlA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EmrE T4SS_pilin
Other DBs
NCBI-GeneID: 939404
NCBI-ProteinID: NP_389108
Pasteur: BG13200
BSORF: BG13200
UniProt: O34428 A0A6M3ZA11
Position
complement(1296620..1297594)
AA seq 324 aa
MKAIVIGILASLFFAVTFILNRAMELSGGSWLWSSSLRFIFMVPFLCLIVIMRGTFTPLL
LEMRKKPFYWIKWSFVGFVLFYAPITFAAAYGPGWLIAGTWQITIVAGVLLSPLFYVKQD
MPGGPQLIRQKIPLVSLGTSVIILIGAALIQLQHAESLSGRMLLFSVLPVVIAAFAYPLG
NRRMLEEYGGRLDTFQRVLGMTLASLPFWLILAAYGWWSDGLPTASQTVQSFIVAVSSGI
IATVLFFWATDMVRDNPQKLAAVEATQSGEVIFALLGEIVLLSGVFPSLLSFAGLFIIIA
GMMLHTFASQPRKPKKKAQSNLTA
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaaagctatcgttatcggaatattggcttcactctttttcgccgttacctttatatta
aacagagcgatggagttatcaggaggcagctggctttggagctcttcgctgcgctttatt
tttatggtgccatttttatgtttgattgtcatcatgagagggacattcacgcctctctta
ctagaaatgaggaaaaagccgttttattggatcaaatggagcttcgtcggtttcgtgctt
ttttacgcaccgattacatttgcggctgcatacggtccggggtggctcatagctggaacc
tggcaaattacaattgtagccggggtgctcttatctcctttgttttatgtcaaacaagat
atgccgggcggtccgcagctcattcgccaaaagattcccctggtttcacttggcacttct
gtgatcatcctgattggagcggctctgattcagcttcagcatgcagaatcgctttctggg
aggatgctgcttttcagtgtgctgccggttgtcattgcggcttttgcctatccgttagga
aaccgaagaatgctcgaagaatacggaggccggcttgatacatttcagcgcgtgcttgga
atgacattggcaagccttccattctggcttatattagcagcttacggctggtggtcagat
ggccttccaacagcaagtcaaaccgttcaatcctttatcgttgccgtcagctcaggcatc
attgcgacggttttatttttctgggccactgatatggtaagagacaatccgcaaaaactc
gcagctgttgaagccactcaatccggtgaagtgattttcgcgctgcttggtgaaattgtt
ctgctgtcaggcgttttcccatctctattatcatttgccggtttgttcattataatagcg
gggatgatgttacataccttcgcttcacagccgagaaaaccgaaaaagaaagcacagtca
aatctgactgcgtag

DBGET integrated database retrieval system