KEGG   Bacillus subtilis subsp. subtilis 168: BSU12270
Entry
BSU12270          CDS       T00010                                 

Gene name
yjlB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cupin_2 Cupin_1
Other DBs
NCBI-GeneID: 939411
NCBI-ProteinID: NP_389109
Pasteur: BG13201
BSORF: BG13201
UniProt: O34612 A0A6M3Z9V9
Position
1297726..1298223
AA seq 165 aa
MERETQTYFFPDDGRIPNHPDFPLVVYQNALKDTGLAERIVTRHGWSNSWSGSVFPYHHY
HSNTHEVLIALRREAVIQFGGEKGAAIPFKSGDAVVIPAGVGHKKLSSSPDFTVLGAYPG
GVQYDMKTGKPNEREEAVKQIKQAALPANDPITGKREPLLEIWVK
NT seq 498 nt   +upstreamnt  +downstreamnt
atggaaagagagacacagacatacttctttccggatgacggcaggattccgaatcaccct
gattttccgctcgtggtgtatcaaaacgcgcttaaggacaccggactggcagagcggatc
gtcacccggcatggctggtcaaacagctggtcagggagtgtttttccataccatcattat
cacagcaatacgcatgaagtcctgattgcccttaggagagaggctgtgattcagtttggg
ggagaaaaaggggctgccatccctttcaaatcaggcgacgcagtcgtgattccagccgga
gtcggacataaaaagctcagctcaagccccgattttactgtccttggcgcctatcccggt
ggcgttcagtacgatatgaagacggggaagccgaatgagcgggaggaagcggtcaaacag
attaagcaggcggcgttgccggcgaatgatccgatcacaggaaaaagagagcctctattg
gaaatatgggtaaagtga

DBGET integrated database retrieval system