KEGG   Bacillus subtilis subsp. subtilis 168: BSU12280Help
Entry
BSU12280          CDS       T00010                                 

Gene name
rex
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1641
Motif
Other DBs
NCBI-GeneID: 939407
NCBI-ProteinID: NP_389110
Pasteur: BG13202
BSORF: BG13202
UniProt: O34633
Position
1298612..1299034
Genome map
AA seq 140 aa AA seqDB search
MPETIDQTNASVSQSQQDLIDQLLKPEVQESLTVLVDQLPKLTELVNILTKSYDFAQSVA
TDEVLKSDTVGAITEILEPVKETAKEVAATAIEAKDRAEASNETIGLFGLLRMLKDPQAQ
KLFRFANSYLEVMNERENQK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaacaatcgatcaaacaaatgcgtctgtcagccaaagccagcaagatcttatt
gatcagctattaaagccagaagttcaagaatcattgactgttttagttgaccagcttccg
aagctgactgagttagtgaatattttaacgaagtcttatgatttcgctcagtctgtagcg
actgacgaagtgttaaagagcgacacagtcggtgcgatcactgaaattctcgagcctgta
aaagaaacagcgaaagaagtagctgcgactgcgatcgaagcaaaagaccgcgcggaagca
agcaacgaaacaattggacttttcggccttcttcgcatgctgaaagatcctcaagctcaa
aagctgttccgttttgctaacagctaccttgaagtcatgaacgaacgcgaaaaccaaaaa
taa

DBGET integrated database retrieval system