KEGG   Bacillus subtilis subsp. subtilis 168: BSU12300
Entry
BSU12300          CDS       T00010                                 

Gene name
uxaC
Definition
(RefSeq) uronate isomerase
  KO
K01812  glucuronate isomerase [EC:5.3.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Module
bsu_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU12300 (uxaC)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.12  glucuronate isomerase
     BSU12300 (uxaC)
SSDB
Motif
Pfam: UxaC GerD
Other DBs
NCBI-GeneID: 936461
NCBI-ProteinID: NP_389112
Pasteur: BG13204
BSORF: BG13204
UniProt: O34808
Position
1300450..1301871
AA seq 473 aa
MEPFMGKNFLLKNETAVSLYHNYAKDMPIIDYHCHLSPKEIYENKTFQNITEAWLYGDHY
KWRIMRANGIEETYITGDAPDEEKFMAWAKTVPMAIGNPLYNWTHLELQRFFGIYEILNE
KSGSAIWKQTNKLLKGEGFGARDLIVKSNVKVVCTTDDPVDSLEYHLLLKEDKDFPVSVL
PGFRPDKGLEINREGFPEWVQALEDAAAISITTYDEFLKALEKRVRFFHSAGGRVSDHAI
DTMVFAETTKEEAGRIFSDRLQGTEVSCEDEKKFKTYTLQFLCGLYAELDWAMQFHINAL
RNTNTKMMKRLGPDTGYDSMNDEEIAKPLYKLLNSVEMKNQLPKTILYSLNPNDNYVIAS
MINSFQDGITPGKIQFGTAWWFNDTKDGMLDQMKALSNVGLFSRFIGMLTDSRSFLSYTR
HEYFRRIVCNLIGEWVENGEVPRDMELLGSIVQGICYDNAKHYFQFQEEKANV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggaacccttcatgggcaaaaactttttattgaaaaatgaaaccgctgtcagcctctat
cacaattatgcgaaagacatgccaattattgattaccactgccacttaagtccgaaagaa
atctatgaaaataagacatttcaaaacatcacggaagcctggctgtatggtgaccattat
aaatggcgcatcatgagagccaatggaattgaggagacatacattaccggagatgcgcct
gatgaggagaaatttatggcttgggcgaaaaccgtgccgatggcgattggcaacccgctc
tacaactggactcacttagaattgcagcgtttttttggcatttacgagattttaaacgag
aagtccgggtcggctatatggaaacagacaaataaactgctcaaaggggaaggcttcggg
gcaagggatttaatcgtgaaatcaaatgtaaaggtcgtgtgcaccacagatgaccctgtt
gattctcttgaataccatttattgttaaaagaagacaaagactttcctgtcagtgtgctg
cctggatttcggccggataaaggacttgagatcaatcgtgaaggctttcctgagtgggtg
caggcgcttgaagatgccgctgccatatcgattacaacctatgatgagtttttaaaggcg
ttggaaaaacgagtgcgattcttccactcagccggcggcagagtttctgatcacgcgata
gatacaatggtatttgccgaaacaacaaaagaagaagctggacggattttttctgacaga
ttacaaggaacagaggtttcttgtgaagatgagaagaaatttaagacatatacgcttcag
tttctttgcggtttgtatgcggagctcgattgggcgatgcagtttcatatcaacgcttta
agaaacacgaatacaaaaatgatgaaaaggctcggacctgatacagggtatgattcaatg
aacgatgaagaaattgctaagcctttatacaagctgctgaactcagttgagatgaagaac
cagctgccgaaaacgattttatattcactgaatccaaatgataactatgtcatcgccagc
atgatcaacagttttcaggacggtattaccccgggaaaaatacaattcggcacagcctgg
tggtttaacgatactaaagacggaatgctcgaccaaatgaaagcgttatcaaatgttggc
cttttcagccgttttatcggcatgctcaccgattccagaagctttctttcgtatacgcgc
cacgaatatttcaggcggatcgtctgcaatttgattggagaatgggtggaaaacggcgaa
gtgccgcgcgatatggagcttctgggaagcatcgttcaggggatttgctatgacaatgcg
aaacactactttcaatttcaagaagagaaagcaaacgtgtaa

DBGET integrated database retrieval system