KEGG   Bacillus subtilis subsp. subtilis 168: BSU12310
Entry
BSU12310          CDS       T00010                                 

Gene name
exuM
Definition
(RefSeq) symporter
  KO
K03292  glycoside/pentoside/hexuronide:cation symporter, GPH family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU12310 (exuM)
SSDB
Motif
Pfam: MFS_2 MFS_1 EI24
Other DBs
NCBI-GeneID: 939410
NCBI-ProteinID: NP_389113
Pasteur: BG13205
BSORF: BG13205
UniProt: O34961 A0A6M3Z9M9
Position
1301939..1303318
AA seq 459 aa
MRTELANKVVSVETEKRLSLKEKMSYGFGDFGNGFMFDLGQIYLLKYFTDVAGIPAAMAG
GIFLVSKLFAAITDPIVGSSIDYRKNIGKRGKFRPYLLIGSIVLAVLTVLIFLSPNVSTT
GKLIYAYASYMIWGIGYSFVNIPYGSLGAAMTQNSEDRTSISTFRQIGSLGALFITSVAV
MPLLVKFDNPKVGYPVVMGLFAALGVFWFYICYRNCKERIIISEAPKEKLTLSSVVKTFI
TNKPLLTLVLMTIFSISAYNIKSAMLVYFAQYNLGNVELMAYMNFIIIGSSFLGVVFLPK
LVKMFGKKRTAMIGFGISVAADLINFMLPSNVYVFTILASIAFIGISIPNGITWALVSDI
IDYGEWKSGERKEATTYSLFNFSRKLAQSLSGFLSGIGLGIIGYVPNAVQTAQALIGIKA
LLLLYPAIALALAMFIIGFLYKLTDQQHAQIVQDLHQKS
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcgaactgaactggcaaataaggttgtgtcggtcgaaacggaaaaaaggctttcattg
aaagagaaaatgtcctatggctttggtgattttggcaacggttttatgtttgatctcggc
cagatttatttattgaagtatttcactgatgtagcgggaatccccgctgcgatggccggc
ggcatttttttagtcagtaagctgtttgcagcgataacagatccaattgtcggctcatca
atcgattatcgcaaaaacatcggcaaacgggggaaattcaggccttatctattaatcggc
agcatcgtgcttgcggtgcttactgttcttatttttctgtctcccaatgtatcaacgacc
ggaaaactgatatatgcatatgcatcctatatgatttggggcatcggctattcgtttgtg
aatattccgtacggctcattaggggcagcgatgactcaaaattctgaggaccggacctcc
atttcgacgttccgccaaatcggatcacttggcgccttgtttatcacaagtgtggccgtg
atgccgctgctcgtcaagtttgataatccgaaggtcggctacccggtggtcatgggcttg
ttcgccgcgctcggtgtgttttggttttatatttgctaccgcaactgcaaagagcgcatt
atcatatcggaagcacccaaagaaaaattaacactctcatctgtcgtcaaaacatttatt
acaaataaaccgctgttaacccttgtcctgatgacgattttttcaatttccgcatacaac
attaaatccgccatgctcgtctatttcgcacaatataacttgggcaatgttgaattaatg
gcttatatgaacttcatcattattggttcttcctttttgggcgtcgtattccttccaaag
ctcgtcaagatgtttggaaagaaacgaacggcaatgatcggctttggcatcagtgtggcc
gcggatctgatcaactttatgcttccatctaacgtttatgtgtttacaattctcgccagt
atcgcctttatcggaatcagtatcccaaatggcatcacgtgggctcttgtctccgatatt
atcgactatggcgaatggaaatccggtgaacggaaggaagcaacgacatattcacttttc
aatttctcaagaaagcttgctcaatctttgtctggctttctctcggggatcggtttgggg
attatcggctatgtgccgaatgcagtccagacagcacaggcgctgattggcatcaaagcg
ctgcttcttctgtatccggccattgctttggcattagcgatgttcattatcggctttctt
tataaactcacagaccagcagcatgctcagatcgttcaggatcttcatcaaaagagctga

DBGET integrated database retrieval system