KEGG   Bacillus subtilis subsp. subtilis 168: BSU12320
Entry
BSU12320          CDS       T00010                                 

Gene name
yjmC
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Ldh_2
Other DBs
NCBI-GeneID: 939828
NCBI-ProteinID: NP_389114
Pasteur: BG13206
BSORF: BG13206
UniProt: O34736 A0A6M4JF46
Position
1303423..1304436
AA seq 337 aa
MKTITIAAEEAKELVWQKLDGAGLNERDAEKVADVLVHADLRNVHSHGVLHTEHYVNRLL
AGGINPGAQPVFKETGPVTGVLDGDDGFGHVNCDMAMDHAIDMAKKKGVGMVTAVNSSHC
GALSYFVQKAADEKLIGMAMTHTDSIVVPFGGRTPILGTNPIAYGVPAKHKKPFILDMAT
SKVAFGKILQAREEGKEIPEGWGVDENGEAVTDPDKVVSLSTFGGPKGYGLSIVVDVFSG
LLAGAAFGPHIAKMYNGLDQKRKLGHYVCAINPSFFTDWDTFLEQMDAMIDELQQSPPAV
GFERVYVPGEIEQLHEERNKKNGISIARSVYEFLKSR
NT seq 1014 nt   +upstreamnt  +downstreamnt
ttgaaaacgataacaattgcagctgaagaagcaaaggaactcgtttggcaaaagctggac
ggtgccggtttgaatgaacgagatgctgaaaaagtggcagatgttctcgtgcacgctgat
ttgcgcaatgtacattcgcatggcgtgctgcacacagaacactatgtgaacaggctttta
gcgggagggatcaatcctggggcacagcctgtttttaaagagacggggcctgtgaccggg
gtgcttgacggagacgatggtttcggtcatgtgaattgcgacatggcgatggaccatgca
attgacatggcgaagaaaaaaggagtcggcatggtcacggccgtaaacagcagccattgc
ggagcgctaagctattttgtgcaaaaagcggctgacgaaaagctgatcggaatggcaatg
acgcatacagacagtatcgttgtcccatttggggggaggactcctattttagggacaaat
ccgattgcttacggagttccggctaagcataaaaaaccgtttatcctagatatggcgaca
tccaaagtggcttttgggaagattctgcaggcccgtgaagagggcaaagaaattcctgaa
ggatggggagtcgatgaaaacggagaagcagtaactgatcctgacaaggtcgtctcactt
tcaacattcgggggcccgaaaggctatggactatcgattgtagtggatgtgttttccgga
ttgctggcgggcgcggcttttggccctcatattgccaaaatgtacaacggccttgatcaa
aaaagaaagctggggcattacgtttgcgcgatcaatccatccttttttactgactgggat
acgtttttagagcagatggatgccatgattgatgaactgcagcaatcaccgccggctgtt
ggattcgaaagagtgtatgtgcccggcgagatcgagcagctgcatgaagaaagaaataag
aaaaacggaatttctatcgcccggagcgtgtatgaattcttaaaaagcaggtga

DBGET integrated database retrieval system