KEGG   Bacillus subtilis subsp. subtilis 168: BSU12330
Entry
BSU12330          CDS       T00010                                 

Symbol
yjmD
Name
(RefSeq) zinc-type alcohol dehydrogenase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C MTS
Other DBs
NCBI-GeneID: 936463
NCBI-ProteinID: NP_389115
Pasteur: BG13207
BSORF: BG13207
UniProt: O35045 A0A6M3ZD69
Position
1304442..1305461
AA seq 339 aa
MKAVQVRKAYDLVTAEVKKPVLSKDDEVLVKVKRVGICGSDMHIYHGTNPLATLPRVIGH
EVTGQVEAVGANVQSLKPGDHVVIEPISYCGSCYACRKGRPNVCAKLSVFGVHEDGGMRE
YIVLPERQLHAVSKDLPWEEAVMAEPYTIGAQAVWRGQVEKGDTVLIQGAGPIGICVLKM
AKLAGAAVMMTDLNNERLAFAKENGADAVVNVQAEHVAERVLEWTGNEGANVVIDAVCLP
ETFALSIEAVSPAGHVVVLGFDERAAQISQLPITKKEVTITGSRLQTNQFPKVVELLNGG
RLMHNGLVTHTFSVDDVHHAFQFIKEHPDQVRKAVITFD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaaagcggttcaagtgcgaaaagcgtatgatctggtgacagcggaggtgaagaagcca
gttctttcaaaggatgatgaagtgctcgtgaaagtcaagcgagtcggcatttgcggttca
gacatgcacatttatcatggaacgaatccgctcgctaccctcccgagagtcatcggacac
gaggtaacgggacaagtggaggcagttggtgcgaatgtacagagcctaaaacccggtgat
catgtggtgattgagccgatttcttattgcggatcgtgctatgcctgccgcaaagggcgg
ccgaatgtttgcgccaagctttctgtatttggcgtacatgaggacggaggcatgcgggaa
tatattgtgcttccggaaagacagcttcacgcggtctcaaaggacttgccttgggaggaa
gcagtcatggccgagccttatacgataggcgcccaggcagtgtggagaggccaggtggaa
aaaggtgataccgtcctgatccagggagcggggcccatcgggatctgtgtgttaaaaatg
gcaaaactggcgggcgctgctgtcatgatgactgacttgaacaacgagcggctggcattt
gcgaaagaaaacggcgccgatgctgttgtaaatgtccaagcagaacatgttgccgagcgg
gtccttgaatggactgggaatgaaggagcaaacgtggtcattgatgctgtttgcctgccg
gagacttttgcactttcaattgaggctgtgtcaccggcgggacatgtggttgtgcttgga
tttgatgaaagagcggctcagatttctcagctgccaattacaaaaaaagaagtcacgata
accggatcccgattgcagaccaatcagtttccaaaagtggtagagcttttgaatggaggc
cggttaatgcataacgggctggtgacccatacattttcagttgatgacgttcatcatgca
tttcagtttattaaggagcatccagatcaggtgcggaaagccgtcatcacgtttgattaa

DBGET integrated database retrieval system