KEGG   Bacillus subtilis subsp. subtilis 168: BSU12340
Entry
BSU12340          CDS       T00010                                 

Gene name
uxuA
Definition
(RefSeq) mannonate dehydratase
  KO
K01686  mannonate dehydratase [EC:4.2.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU12340 (uxuA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.8  mannonate dehydratase
     BSU12340 (uxuA)
SSDB
Motif
Pfam: UxuA AP_endonuc_2
Other DBs
NCBI-GeneID: 939409
NCBI-ProteinID: NP_389116
Pasteur: BG13208
BSORF: BG13208
UniProt: O34346 A0A6M3ZA09
Position
1305486..1306565
AA seq 359 aa
MNMTFRWYGRGNDTVTLEYVKQIPGVKGIVWALHQKPVGDVWEKEEIRAETEYIQSYGFH
AEVVESVNVHEAIKLGNEERGRYIENYKQTIRNLAGFGVKVICYNFMPVFDWTRTDMFRP
LEDGSTALFFEKAKVESLDPQELIRTVEEASDMTLPGWEPEKLARIKELFAAYRTVDEEK
LWDNLSFFLQEILPVAEAYGVQMAIHPDDPPWPIFGLPRIITGEASYKKLRAISDSPSNC
ITLCTGSMGANPANDMVEIAKTYAGIAPFSHIRNVKIYENGDFIETSHLTKDGSINIQGV
MEELHKQDYEGYVRPDHGRHLWGEQCRPGYGLYDRALGIMYLNGLWDAYEAMAKKEVGI
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaatatgacattccgatggtatggacgaggcaacgatacagtcacacttgaatacgtg
aagcaaattcccggtgtcaaaggcatcgtttgggctctccatcaaaagcccgtcggcgac
gtgtgggaaaaagaagaaatcagagccgaaactgaatatattcaatcctatggttttcat
gctgaagttgtagaaagcgtgaatgttcacgaagcgattaaacttgggaacgaagaacgc
ggccggtatattgaaaactacaagcaaacgatccgcaaccttgccggatttggcgtgaaa
gtgatctgctataattttatgccggtttttgattggacacgcacggacatgttccggccg
ctagaagatggatcgaccgctctgttttttgaaaaggccaaggtggaaagccttgatcct
caagagctgattcggacggtggaggaagcatccgacatgacactgccggggtgggagccc
gaaaaattggctcggatcaaagagctttttgctgcctacagaacggtcgatgaagaaaag
ctatgggacaatttatcattctttttgcaggaaattcttcctgttgctgaggcctatggt
gttcaaatggccattcatccggatgacccgccgtggccgattttcggactgccgcgcatt
atcacaggagaggcaagctataagaaactgcgggcgatatcagattcaccgtctaattgt
atcaccctttgtacaggttcaatgggagccaatcccgctaacgacatggtggagatcgct
aaaacgtatgccggcatcgctccattttcacatattcgcaatgtgaaaatttatgagaat
ggcgattttattgaaacatctcatttaacaaaggatggttcgatcaacattcaaggcgtg
atggaagaactgcataagcaggattacgaaggatatgtcagaccggatcatgggcgccat
ctttggggcgagcaatgccgcccgggatatggcttatacgatcgggcacttggcatcatg
tatttgaacgggctgtgggacgcttatgaagcaatggcaaaaaaagaggtgggcatatga

DBGET integrated database retrieval system