KEGG   Bacillus subtilis subsp. subtilis 168: BSU12350
Entry
BSU12350          CDS       T00010                                 

Gene name
yjmF
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Shikimate_DH Epimerase Sacchrp_dh_NADP NAD_binding_2 THF_DHG_CYH_C Glyco_trans_4_4 2-Hacid_dh_C NmrA His_biosynth Oxidored_nitro PipA
Other DBs
NCBI-GeneID: 939418
NCBI-ProteinID: NP_389117
Pasteur: BG13209
BSORF: BG13209
UniProt: O34896 A0A6M3ZEZ2
Position
1306562..1307398
AA seq 278 aa
MIPLHENLAGKTAVITGGSGVLCSAMARELARHGMKVAILNRTAEKGQAVVKEITAAGGT
ACAVAADVLDRMSLERAKEDILGQFGAVDLLINGAGGNHPDAITDVETYEEAGEGQSFFD
MDERGFLTVFSTNFTGAFLASQVFGKELLKADSPAIINLSSMSAYSPMTKVPAYSAAKAS
INNFTMWMAVHFAETGLRVNAIAPGFFLTKQNHDLLINQDGTFTSRSHKIIAGTPMKRFG
KPEDLLGTLLWLADESYSGFVTGITVPVDGGFMAYSGV
NT seq 837 nt   +upstreamnt  +downstreamnt
atgatcccgctgcatgagaacctggctggtaaaacggctgtcatcactggcggcagcggc
gtgctttgctctgcgatggcccgggagctagcccgtcatggcatgaaggtggcgattttg
aatcggacggctgaaaaaggccaagcggtcgtgaaggagataacggcggctggcggcaca
gcgtgcgctgttgctgcggatgtgctggacaggatgtcactggagcgggcaaaggaagac
atccttggccaatttggcgctgttgatctgttaattaacggggctggcggcaatcatcct
gacgcgataaccgatgtggagacatatgaagaagcgggagaaggccaatccttttttgat
atggatgagaggggctttctaactgtattctccaccaacttcaccggtgcgtttctggcc
tcgcaagtgtttggtaaagaactgctgaaggcggattcacccgcgatcatcaacctttct
tccatgagtgcttattcacctatgacgaaggttccggcatacagtgctgcgaaagcatcc
atcaataattttacgatgtggatggctgttcattttgccgaaaccgggctgcgggtcaat
gcgattgccccaggcttctttctgacaaaacaaaatcatgatctgctgatcaaccaagac
ggaacgttcaccagccgatctcacaaaattattgcgggaacaccgatgaagcgcttcgga
aaaccggaggatttgctcggtacgctcctttggctggcggatgaatcctattccggtttt
gtcactgggatcaccgttcctgtcgatggaggatttatggcttattcaggtgtgtaa

DBGET integrated database retrieval system