KEGG   Bacillus subtilis subsp. subtilis 168: BSU12360
Entry
BSU12360          CDS       T00010                                 

Gene name
exuT
Definition
(RefSeq) hexuronate transporter
  KO
K08191  MFS transporter, ACS family, hexuronate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU12360 (exuT)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    BSU12360 (exuT)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Other DBs
NCBI-GeneID: 939405
NCBI-ProteinID: NP_389118
Pasteur: BG13210
BSORF: BG13210
UniProt: O34456 A0A6M4JHK6
Position
1307446..1308714
AA seq 422 aa
MFSKDKLPVILFLFLAGVINYLDRSALSIAAPFIQDDLTLSATQMGLIFSSFSIGYAIFN
FLGGVASDRYGAKLTLFVAMVVWSLFSGAVALAFGFVSLLIIRILFGMGEGPLSATINKM
VNNWFPPTQRASVIGVTNSGTPLGGAISGPIVGMIAVAFSWKVSFVLIMIIGLIWAVLWF
KFVKEKPQETIKEAPAIKAETSPGEKIPLTFYLKQKTVLFTAFAFFAYNYILFFFLTWFP
SYLVDERGLSVESMSVITVIPWILGFIGLAAGGFVSDYVYKKTARKGVLFSRKVVLVTCL
FSSAVLIGFAGLVATTAGAVTLVALSVFFLYLTGAIYWAVIQDVVDQNNVGSVGGFMHFL
ANTAGIIGPALTGFIVDQTGTFSGAFLLAGGLAVFASLAVIRFVRPIIGKPAGTEAENPV
SY
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgttttcaaaagataagcttcccgttatcctttttttgttcctggcaggggtgattaat
tacctggatcgctcggcgctttccattgcagctccttttattcaggatgatctcacattg
tctgccacacaaatgggcttgattttcagcagtttttcgataggttatgccatttttaat
tttcttgggggcgtggcatccgaccgctatggggcaaagctgaccttgtttgtcgcgatg
gttgtttggtcgctgtttagcggagcagtcgccctcgcttttggctttgtcagcctgctg
attatacgcattctcttcggaatgggagaaggcccgctttcggcgaccatcaacaagatg
gtgaacaactggttcccgccgacccagcgggcgtccgttatcggtgtaaccaacagcggc
acgcccctcgggggagccatttccggcccgatagtcggcatgatcgcagtggcgttcagc
tggaaggtatccttcgttctcattatgattattggattgatatgggcagtgctctggttc
aagtttgtcaaagaaaagccgcaagagacgatcaaggaagcaccggcaataaaagcagaa
acgtctcccggagaaaaaattccgctcaccttttacctgaagcaaaaaacagtcctgttc
acggcgttcgcttttttcgcttacaactacatcctcttcttctttttgacatggtttccg
agctatcttgtcgacgagcggggattaagtgttgaatcgatgagtgtcatcacggtcata
ccgtggattttaggatttatcgggctggctgcggggggatttgtttctgactatgtgtac
aaaaaaacggcccgaaaaggtgtgctgttctcgcgcaaggttgtgcttgtcacgtgtttg
ttttcatcagctgtcctgattggttttgccgggcttgtggcaacgactgcgggggctgtc
actcttgtcgctctgtcagtgttctttctttatttgaccggtgctatctattgggctgtc
attcaagatgtggttgatcaaaacaatgtcggttctgttggcggcttcatgcatttcctc
gccaacacggcaggaattatcggcccggctttaaccggatttattgttgaccaaacaggc
acgttttctggagcatttttgcttgccggtgggctggctgtcttcgcttcacttgctgtg
attcgttttgtccgtccaatcattggtaagccagcgggaacagaagctgagaatcctgtg
tcttattaa

DBGET integrated database retrieval system