KEGG   Bacillus subtilis subsp. subtilis 168: BSU12370
Entry
BSU12370          CDS       T00010                                 

Gene name
exuR
Definition
(RefSeq) LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_Tnp_ISL3 HTH_38 HTH_23 HTH_7 MarR_2 HTH_10
Other DBs
NCBI-GeneID: 939834
NCBI-ProteinID: NP_389119
Pasteur: BG13211
BSORF: BG13211
UniProt: Q9JMQ1 A0A6M3ZA20
Position
1308802..1309803
AA seq 333 aa
MVTIKDIAKLANVSHTTVSRALNNSPYIKEHTKKKILELAEQLNYTPNVNAKSLAMQKSH
TIGLFFTSITNGTSHSFFADTIKGVNQAISEDYNLYVRGIDDLKNYDSVTPMRYDGIILM
SQSDIDNSFIYHIREKNIPLVVLNRDIDDRTITNILSNDKEGSQEAVEYFIQSGHQDIAI
IEGIEGFKSSQQRKEGYLSALIQHHIPIKHEYSVKGQYDMESGFQAMERLLALPNPPTAV
FCSNDDMAIGAMNAIFAKGLRVPDDISVIGFDDIGFSQYITPRLSTVKRPVEKISVLGAQ
KLLSLISEPETKAEKILENTEFMVRDSVRRLTT
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggtaaccataaaagatatcgcaaaactcgcaaacgtatcccacactactgtttccaga
gcactcaacaacagcccttacatcaaagaacatacgaagaaaaaaatattagagctagca
gagcagctcaactatacaccaaatgtaaatgcgaaaagtctggcgatgcaaaagtcgcat
acgatcgggctattctttacaagcattacaaacggaacctcacacagcttctttgcagac
actatcaaaggcgtcaatcaagccataagtgaggattacaatctgtatgtgcgcggcatt
gatgatctgaaaaactatgactccgttacaccgatgagatatgacggcatcattttaatg
agccaaagtgacattgataattcttttatttaccatattcgcgaaaaaaacattccgctt
gtcgtgctgaatcgtgatattgatgatcgtaccatcacgaatattttgtccaatgacaag
gaaggctctcaagaagctgtagaatacttcattcagtccggacatcaagacatcgccatc
atcgaggggatcgaaggctttaaatcctcccagcagcgaaaggaagggtacttatccgca
ctgattcaacatcatattccgatcaagcatgaatacagtgtcaaaggacagtacgatatg
gaaagcggctttcaagcgatggagcggctgctggcactgccgaatcctccaaccgctgtt
ttttgttcgaatgatgacatggcaatcggagcgatgaatgcgatattcgcaaagggcctg
cgcgttcctgatgatatttcggtgatcgggtttgatgatattgggttttcacagtacatc
acgccaaggctttcaacagtaaagcgcccagtggagaaaataagcgtgctcggtgcgcaa
aaactcttgtcgctgatcagcgagcccgaaacaaaagcagaaaaaatcttggaaaacaca
gaatttatggtgcgtgattcagtcagacgattgacgacgtga

DBGET integrated database retrieval system