KEGG   Bacillus subtilis subsp. subtilis 168: BSU12380
Entry
BSU12380          CDS       T00010                                 

Gene name
uxaB
Definition
(RefSeq) altronate oxidoreductase
  KO
K00041  tagaturonate reductase [EC:1.1.1.58]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Module
bsu_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU12380 (uxaB)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.58  tagaturonate reductase
     BSU12380 (uxaB)
SSDB
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Other DBs
NCBI-GeneID: 936468
NCBI-ProteinID: NP_389120
Pasteur: BG13212
BSORF: BG13212
UniProt: O34354 A0A6M3Z9W6
Position
1309880..1311322
AA seq 480 aa
MQKLNKNVYDHYTQYPEKILQFGEGNFLRGFIDWQIDQLNQHTDFNGSVAVVQPRGSEKI
KRLNEQDGLYTLFLQGMKDGEAVNEHMIINSISRGIDLFSDYEAYKELASSERLRFIISN
TTEAGIVCDEKDRLEDRPQKTFPGKLTAFLYFRYQAFKGDQTKGCVLIPCELIENNGEKL
RETVLHYAHLWKLEEGFTQWIHEANTFCNSLVDRIVPGFPVDSIDEITADLGYQDDLIVV
GEQYYLWVIEGPDWIGKELPFAAAGLHTKIVSDLTPYRTKKVRILNGAHTAMTPVALLYG
LKTVRDAVEHPEVGRFIRELIDDEILPVLKMEGLSQYADDVLNRFKNPYIKHYLESIALN
AISKFKTRNLPTLKEYAEQKGQLPERLVFSFSALLYFYHDNETLQDDPAVLQFFKEVWCQ
EDGDMLRIASRVLGEQRLWGADLNEIPKLTDRVAVYLNHIHELGMQRALEQYCIQGGEVR
NT seq 1443 nt   +upstreamnt  +downstreamnt
gtgcagaagctgaataaaaatgtgtacgatcactatactcagtatccagaaaaaattctc
caattcggagaaggaaactttcttcggggatttatcgattggcagattgatcaattgaat
caacacactgattttaatgggagcgtggcagttgtccagccaagaggctcagaaaaaatc
aaacgattaaatgagcaagatggattatatacactttttttacaaggaatgaaagacgga
gaagcggtaaacgagcatatgattatcaactcaatcagccggggaattgacctgttttct
gattatgaagcatacaaagaattggcatcaagcgaaaggcttcggtttattatctccaac
accactgaggctgggattgtatgtgatgaaaaagatcgtttagaggataggccgcaaaaa
acattccctgggaaattaactgcatttctttactttcgctatcaggcttttaaaggagat
cagacaaaagggtgtgtcctgatcccatgtgaactgatcgagaataacggtgaaaagctg
agggaaacggttcttcattatgcacatctgtggaagctggaggaaggatttacacagtgg
attcatgaggccaatacattttgtaatagtttagtagaccggattgttccgggttttccc
gtcgacagcattgatgagatcacggcagatcttggctatcaggatgatttgatagttgtg
ggagagcaatattatttgtgggttatcgaggggcctgattggattggaaaagaacttccc
tttgcggctgcagggctgcatacaaagatcgtcagcgacctcaccccataccggactaaa
aaagtaagaattttaaatggcgctcatacagcaatgacgccagtggctttattatacggc
ttgaagactgttagggatgcagtcgagcatccggaagtggggcgatttataagagagctg
attgatgacgaaattcttcctgttttaaaaatggaaggtctttctcagtatgctgacgat
gtgctgaaccgttttaaaaacccgtatattaagcattacctggaaagcattgcattgaac
gccatttccaaattcaaaacgagaaacctgccgactcttaaggaatatgctgaacaaaag
ggacagcttcctgaacgcttggtgttttctttcagcgctcttctgtatttttatcatgat
aacgagacattgcaggatgatccggcagttcttcaatttttcaaagaggtttggtgtcag
gaggatggcgacatgcttcggattgcatcaagagtgttaggcgaacagcggctgtggggg
gcagatctcaatgagataccgaagctgactgatagagtcgctgtttacttgaatcatatt
catgagctgggcatgcagagggctcttgaacaatactgcatacaagggggagaggtacgt
tga

DBGET integrated database retrieval system