KEGG   Bacillus subtilis subsp. subtilis 168: BSU12390
Entry
BSU12390          CDS       T00010                                 

Symbol
uxaA
Name
(RefSeq) altronate dehydratase
  KO
K01685  altronate hydrolase [EC:4.2.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
bsu01100  Metabolic pathways
Module
bsu_M00631  D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU12390 (uxaA)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.7  altronate dehydratase
     BSU12390 (uxaA)
SSDB
Motif
Pfam: GD_AH_C SAF
Other DBs
NCBI-GeneID: 939837
NCBI-ProteinID: NP_389121
Pasteur: BG13213
BSORF: BG13213
UniProt: O34673 A0A6M3Z9K9
Position
1311319..1312812
AA seq 497 aa
MKSFIKIHKQDNVLLALRDIQKGERLHAYGVSIEVKDDIKRGHKIALQSIKENDSIVKYG
FPIGHASQDISIGEHIHVHNTKTNLSDIQLYSYTPRFDENPYSNENRTFKGFRRENGDAG
VRNELWIVPTVGCVNGIAEKMLQRFVRETGDIAPFDNVLVLKHQYGCSQLGDDHENTKQI
LLNAIRHPNAGGVLVLGLGCENNELARMKEALQDVNLKRVKFLESQSVTDEMEAGVALLK
EIHEAAKGDKREDIPLSELKIGLKCGGSDGFSGITANPLLGRFSDYLIAQGGSTVLTEVP
EMFGAETILMQRAANEEVFHKIVDLINDFKQYFIKHDQPVYENPSPGNKAGGISTLEDKS
LGCTQKAGISPVTDVLKYGEVLKTKGLTLLSAPGNDLIASSALAAAGCQIVLFTTGRGTP
FGTFVPTVKVATNTELYEAKPHWIDFNAGLLAEDDVHEEYVLREFIHYMIEVASGQLVNH
EKNDFKELAIFKSGVTL
NT seq 1494 nt   +upstreamnt  +downstreamnt
ttgaagtcgtttataaagattcataagcaagataatgtccttcttgctctgcgggatatt
caaaagggagagaggctgcatgcttacggcgtgtcgattgaagtaaaggatgatataaaa
agaggccataagattgcattgcagtctatcaaagaaaacgacagcatcgtcaagtacggg
tttccaatcggtcatgcatcacaagatatctcgatcggagagcatattcatgtccataat
acgaaaacaaacctgtctgatatccaattatacagctatacaccgagatttgatgaaaat
ccgtattctaatgagaaccggacgtttaaaggttttagaagagaaaacggagatgcgggt
gtacggaatgaattgtggattgtcccaactgtcggctgtgtcaatggaatagcagaaaaa
atgctgcagcgttttgtcagagaaacaggggatatcgctccatttgataacgtactggtg
ttaaagcatcaatacggatgctcgcagcttggcgacgatcatgaaaatacgaagcagatc
ctgctgaatgccattcgccatccaaatgccggcggcgtcttggtgttagggcttggctgt
gaaaacaatgagctggcaagaatgaaggaagcactgcaagatgtgaacttgaagcgggtg
aagtttctggaatcccagtcggtgaccgacgaaatggaggcaggcgttgctttgctgaag
gaaattcatgaagcggccaaaggagataagagagaagacattccgctgtctgaactgaag
atcgggctgaaatgcggaggttcggacggtttttccggcataaccgcaaacccgctgctt
ggacgtttttcagattatctcattgcacagggagggagtactgtgctgacggaagtaccg
gaaatgttcggcgcagaaaccatcctgatgcagcgggctgccaatgaagaagtgtttcat
aagatagtcgatttaatcaatgatttcaaacaatactttattaaacatgatcagccggtg
tacgaaaatccttcaccgggcaacaaagcgggcggcatttctacacttgaggataaatcg
ctgggctgtacgcaaaaagcggggatttctcctgtcacggatgtcttgaaatacggtgaa
gtactcaagacaaaagggctgactcttttgagcgcaccgggcaatgatttgatcgcctcc
tccgcattggcggctgccggctgccaaattgtcctctttacaacgggaagaggcacgccg
tttggcacctttgtcccgacggtgaaagtagcgacaaacaccgagctgtatgaggcgaag
ccgcattggattgattttaacgcaggccttttagcagaggatgatgttcatgaggaatat
gtgctgcgtgagtttatccactatatgattgaggtggcaagcggccagcttgtgaaccat
gaaaaaaatgatttcaaagaactcgccatttttaaatcgggtgtgacgttataa

DBGET integrated database retrieval system