KEGG   Bacillus subtilis subsp. subtilis 168: BSU12400
Entry
BSU12400          CDS       T00010                                 

Gene name
yjnA
Definition
(RefSeq) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU12400 (yjnA)
SSDB
Motif
Pfam: TauE
Other DBs
NCBI-GeneID: 939412
NCBI-ProteinID: NP_389122
Pasteur: BG13214
BSORF: BG13214
UniProt: O34578 A0A6M4JM68
Position
complement(1312851..1313615)
AA seq 254 aa
MSVSIILMGLFVGALVGLTGVGGAALLTPLLIVLGINPSIAVGTDLVYNSITKLFGVASH
WRQKTINFKLVKYLAIGSIPSASLAIGILHLFPAFHQHQEEIIKHALGYVLTLVAISIIV
RLFLDRKLRPNRWQLMPLENKRALTILIGVVFGFIVGLTSIGSGSLFAIAMIYLFNMKAS
QIVGTDIAHAFLLVTAAGILNASFGSVDYMLAANLLLGSIPGVLIGSHLSPRFSPRPLQF
IMASIILVSGLKLI
NT seq 765 nt   +upstreamnt  +downstreamnt
atgagtgtaagcatcatattgatgggtttgtttgtcggagccttagtcggattgacggga
gtgggtggagcggccttattaactccccttttaattgtgcttggaattaatccttccatc
gcggtcggtacggatcttgtatataactcgatcacaaagctgtttggcgttgcctcccat
tggcggcagaaaacgattaactttaaattggtaaaatacttagccatcggcagtattccg
agtgcttcgctagccattggcatattgcatttgttccccgcctttcaccagcatcaggaa
gaaattattaagcacgctctaggatatgtgttaacgctggttgccatttcaatcatcgtt
cgtttgtttttggatagaaaacttcgccccaaccgctggcagctgatgccgcttgaaaat
aagagggcgctgacaattcttattggtgttgtgtttgggtttatcgtcggattaacatca
atcgggtccggctcattatttgcaatcgccatgatttacttatttaacatgaaagcgtca
cagattgtcggaaccgatatcgcgcatgcttttcttcttgttacggcagcaggcattttg
aacgcaagcttcggaagcgtggattacatgctggcagctaatctgctcctcggttcaatt
cccggcgtactgatcgggagccatctttcgcctcgattctccccgcgtccactgcaattt
attatggcttccattattttagtcagcggtttaaaattgatttaa

DBGET integrated database retrieval system