KEGG   Bacillus subtilis subsp. subtilis 168: BSU12410
Entry
BSU12410          CDS       T00010                                 

Gene name
yjoA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DinB DinB_2 DUF664 ATR13
Other DBs
NCBI-GeneID: 939416
NCBI-ProteinID: NP_389123
Pasteur: BG13215
BSORF: BG13215
UniProt: O34334 A0A6M3Z9P0
Structure
PDB: 
3DKA

Position
complement(1313840..1314304)
AA seq 154 aa
MCQSNQIVSHFLSHRNVTNELAEKISKDHYSYKPAETSMSAEELVKHILTSFHLFANVIK
EGNASPFQNKQEETETDLNVLAKTYTEKTVAILEQLTEEQLDREIDLTSAFGRKVTGRAL
LQLAMEHEIHHKGNLFVYVREMGHTELPFYQQRM
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtgccaatccaatcaaattgtcagccattttttatcccatcgaaacgtgaccaatgag
cttgccgaaaaaatcagcaaagaccattacagctacaaaccggcagaaacatcaatgtca
gcagaagagctggtcaaacacattcttacgtctttccacttgttcgcaaatgtcattaag
gaaggcaatgcctcaccatttcaaaacaagcaggaagaaacagaaacagatctcaatgtt
ctggcaaaaacatatacagaaaaaacggtcgctatccttgaacagctgactgaagagcag
ctggacagagaaattgatctgacatccgctttcggcagaaaagtcacaggccgcgcgctg
cttcagcttgcaatggagcatgaaattcaccataaaggcaacctgttcgtgtatgtgcgg
gaaatgggccacactgagcttcctttctatcagcagcgcatgtag

DBGET integrated database retrieval system