KEGG   Bacillus subtilis subsp. subtilis 168: BSU12450
Entry
BSU12450          CDS       T00010                                 

Gene name
yjpA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YCII DUF2371
Other DBs
NCBI-GeneID: 939831
NCBI-ProteinID: NP_389127
Pasteur: BG13217
BSORF: BG13217
UniProt: O34446 A0A6M4JHM7
Position
complement(1317157..1317414)
AA seq 85 aa
MYTYLMLTMRTEKFNQEHVAGHYEFLDRLQAEKRLKMFGPFSDATGGAYVIEADSLEEAA
EIGHADPLVASGSSELTIKEWKLKK
NT seq 258 nt   +upstreamnt  +downstreamnt
atgtatacatatttaatgctgacaatgagaacggagaaatttaatcaggagcatgtggct
gggcactatgaatttctggatcgtttacaggcagaaaaacgtttaaaaatgtttgggcca
ttcagcgacgccacaggcggagcgtatgtcatcgaagcagattcactggaagaggcagcg
gaaatcggccatgcggatccgctggtggcaagtggatcttctgagctgacgataaaagaa
tggaagctgaagaaataa

DBGET integrated database retrieval system