KEGG   Bacillus subtilis subsp. subtilis 168: BSU12470
Entry
BSU12470          CDS       T00010                                 

Symbol
yjqA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: bPH_1 bPH_3
Other DBs
NCBI-GeneID: 939415
NCBI-ProteinID: NP_389129
Pasteur: BG13218
BSORF: BG13218
UniProt: O34593 A0A6M4JH56
Position
complement(1318528..1318905)
AA seq 125 aa
MGFIDGLLGNASTLSTAAVQEELAHILLEGEKVEAAFKLVRDLIVFTDKRLILVDKQGIT
GKKTEFQSIPYKSISRFSVETAGRFDLDSELKIWISGAELPAVSKQFKKDESIYDIQKVL
AAVCM
NT seq 378 nt   +upstreamnt  +downstreamnt
atggggtttattgatggattactcggcaatgcatcaacactgtcaacggcagctgtgcaa
gaagagcttgcccatattttacttgagggtgagaaggttgaagccgcgtttaagctggtt
cgcgatttgattgtctttactgacaagcggcttatccttgtagataaacagggaattaca
ggcaagaaaacggaatttcaatcgattccgtacaaaagcatttccagattcagcgtggaa
actgccggccgctttgaccttgattcagagctgaaaatttggatctccggcgcggaactt
cccgctgtctcaaagcagtttaaaaaagatgaaagcatttatgatattcaaaaggtgctt
gccgcagtttgtatgtaa

DBGET integrated database retrieval system