KEGG   Bacillus subtilis subsp. subtilis 168: BSU12480
Entry
BSU12480          CDS       T00010                                 

Gene name
yjqB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Gamma_PGA_hydro
Other DBs
NCBI-GeneID: 939423
NCBI-ProteinID: NP_389130
Pasteur: BG13219
BSORF: BG13219
UniProt: O34785 A0A6M3ZA28
Position
1319011..1319613
AA seq 200 aa
MEDMYDSFAALSASESEYRIIYEEKNGSELIVLGPHGGRIEPGVSELVRAFSDRCSIYLF
EGLKQRNNRSLHLTSIRFDEPLALEKVNDHHYALAFHGYYDPKIPHTLVGGADRKKAKLI
CERLNEAGFSAELTNEKDRLAGVHPNNIVNRTKREMGLQLEVSTAQRNALFRNFGCRDKS
YIQNDLFDRYVEAVKLGFYT
NT seq 603 nt   +upstreamnt  +downstreamnt
atggaagatatgtatgacagctttgcggccctttctgcttctgagtcggagtaccggatt
atttatgaggagaaaaacggaagtgagcttatcgtcctcggtcctcacggcggcagaatt
gagcctggcgtcagtgaactggtgcgggcattttcggatcgatgttccatctatttgttt
gagggtctaaagcagcgaaacaaccgttccttgcatctcactagcattcgttttgatgag
ccgctggctttagaaaaagtgaatgaccaccattacgcattagcgtttcacgggtattat
gatccgaaaatcccgcatacattggtcggcggggcggatcgtaaaaaagccaagctcatt
tgtgagcgtctgaatgaagcgggttttagcgccgagctcactaatgagaaagaccgcctg
gcaggtgtacacccaaacaatattgtcaatcggacgaaaagagaaatgggactgcaattg
gaggtaagcacggcacagcgaaatgcgctattccgcaattttgggtgccgtgataaaagc
tacatacaaaacgatttgtttgatcgatatgtggaagccgtcaagcttggcttttataca
taa

DBGET integrated database retrieval system