KEGG   Bacillus subtilis subsp. subtilis 168: BSU12490
Entry
BSU12490          CDS       T00010                                 

Gene name
yjqC
Definition
(RefSeq) hypothetical protein
  KO
K07217  Mn-containing catalase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BSU12490 (yjqC)
SSDB
Motif
Pfam: Mn_catalase DUF6306
Other DBs
NCBI-GeneID: 939414
NCBI-ProteinID: NP_389131
Pasteur: BG13220
BSORF: BG13220
UniProt: O34423 A0A6M4JFJ6
Position
1319690..1320526
AA seq 278 aa
MFYHIKELQYQAKPAHPDPVYAKKLQEVLGGQFGEISVMMQYLFQGFNCRADAKYKDLLY
DVGTEEIGHVEMLATMISRLLDNAPADVQEDAYKSNPAIAAVMSGMNPQHAIVSGLGAMA
SDSEGYPWNAKYIISSGNLLADFRANLNAEAQGRLQVTRLYAMTDDPGVRDMLSFLIARD
TYHQNMWYAAIKELEERERDIVVPTTFPRELEKQEVSYDLFNFSRGDESSQGRWAHGEAF
DGRGEFRYIPAPIAFASAPHLKPAPMWLHNTVPPMSKC
NT seq 837 nt   +upstreamnt  +downstreamnt
atgttttatcatataaaagagcttcaatatcaagcaaagccagctcatcccgatccggtt
tatgcgaaaaaacttcaagaggtgctcggcggccaattcggtgaaattagcgtcatgatg
cagtatttgtttcaagggtttaactgcagggcggatgctaagtataaagatttgttatat
gatgtggggaccgaagagattgggcacgtagaaatgctggcaacgatgatttccaggctt
ctggacaatgcacccgcggatgtacaggaggatgcttataaaagcaatcccgctattgca
gcagtcatgtcagggatgaaccctcagcacgcgattgtgtccggattgggggcgatggca
tcagatagtgagggctatccgtggaatgcaaaatacattatctcaagcggaaacctgctg
gccgattttcgcgctaacttaaatgcggaggcccaaggacgccttcaggtgacacggctt
tatgccatgaccgatgatccaggggtaagagatatgctgtcatttttgattgcaagggat
acctatcatcaaaatatgtggtacgcggccattaaagagctggaggaaagagaacgggat
attgtcgtcccgacgacgtttccgcgtgagctcgaaaagcaggaagtctcctatgacctg
tttaacttttccaggggagatgaaagctcacaaggaagatgggcacatggggaagccttt
gacggccggggtgaattcaggtatatcccggctccgattgcgttcgcatctgcgcctcat
cttaaaccggcgcccatgtggctgcataatacagttcccccaatgtcgaaatgttag

DBGET integrated database retrieval system