KEGG   Bacillus subtilis subsp. subtilis 168: BSU12500
Entry
BSU12500          CDS       T00010                                 

Symbol
xkdA
Name
(RefSeq) phage-like element PBSX protein XkdA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Peptidase_M78
Other DBs
NCBI-GeneID: 939838
NCBI-ProteinID: NP_389132
Pasteur: BG10993
BSORF: BG10993
UniProt: P39780 A0A6M4JM73
Position
complement(1320570..1321166)
AA seq 198 aa
MGDYLSHLEEYVKNLYGRLGITSPHHIDMLKIAKDLDIWVHFEDMGSMMVKYDGMYSIVL
NQKKSREEQWEDFGHELCHVLKHAGNHFQMNKLFRELQEFQANQFMYHFCVPTFMLLQME
LPQWRSQALATIAAVFRVTKEFADKRLDMFERRKAGIQFQKRLAYLLSHKRPNAYEEGDQ
QHLQVAEEKALYHIGKNI
NT seq 597 nt   +upstreamnt  +downstreamnt
ttgggcgattacttatcacatctggaggaatacgttaaaaatttatacggccggctgggc
atcacatcccctcatcacattgacatgctgaaaatcgcaaaggatctggatatttgggtg
cattttgaggatatggggagcatgatggtgaaatacgacggcatgtacagtatcgtattg
aaccaaaaaaagtcacgggaagagcaatgggaggattttggccatgagctgtgccacgtg
ttaaagcatgcaggcaatcattttcagatgaacaagctcttcagagagcttcaggaattc
caggcaaatcaatttatgtaccacttctgtgtgccaacctttatgctgttgcagatggaa
ctgccgcaatggagaagccaggcactcgccacaattgcggcggtattccgggtaacaaag
gaatttgctgataaaaggcttgacatgtttgaacggcgtaaagcaggtattcaatttcag
aagcggctcgcttatttattatctcacaagcggccaaatgcgtacgaggaaggcgatcag
cagcacttgcaggtcgctgaggaaaaagcgttatatcatattggtaaaaacatctga

DBGET integrated database retrieval system