KEGG   Bacillus subtilis subsp. subtilis 168: BSU12519
Entry
BSU12519          CDS       T00010                                 

Gene name
yjzJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ADD_ATRX
Other DBs
NCBI-GeneID: 8303027
NCBI-ProteinID: YP_003097711
UniProt: C0H3Z4 A0A6M3Z9P5
Position
1321848..1322027
AA seq 59 aa
MYPIQIVFSENPIDQRHLGQSGGTISFTACGLPVFHFETQEQFQAYMMLKGEAAYNEKR
NT seq 180 nt   +upstreamnt  +downstreamnt
atgtatccgatccaaatcgtttttagtgaaaatcccatagatcagcgccatctcggacaa
tccggcggcaccatttcgtttaccgcatgcggccttccggtgtttcactttgaaacgcag
gaacagtttcaagcatacatgatgttaaaaggagaagcggcgtacaatgaaaaacgataa

DBGET integrated database retrieval system